SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777271|ref|YP_007169058.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777271|ref|YP_007169058.1|
Domain Number 1 Region: 355-539
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.31e-60
Family Pyruvate oxidase and decarboxylase PP module 0.0000497
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.91e-55
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000206
Further Details:      
 
Domain Number 3 Region: 179-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 6.55e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777271|ref|YP_007169058.1|
Sequence length 545
Comment acetolactate synthase large subunit [Halothece sp. PCC 7418]
Sequence
MNTAELLVKCLENEGVEYIFGLPGEENLDLLEALKDSSIQFITVRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLIAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNKQIVRPNTTPELLRRAFKIAQQEKPGAVHIDLPENIAAMPAEGLPLAKDGREQIY
ASSGSIEKAAEVISKADNPVILAGNGVIRSQAAQQLTTFATRLNIPVVNTFMGKGAIPYT
HPLSLWTVGLQQRDFISCAFEQSDLVIAIGYDLIEYSPKRWNPNGTTPILHIAETASEID
SSYIPLGEVVGDIGNSLDQIIEQVHRDGKPLPIFANVRSEIRADYEFYAHDEEFPIKPQK
IIYDLRQVMGAQDIVISDVGAHKMWMARHYHCESPNTCLISNGFAAMGISIPGALAAKLL
YPEQNVVAVTGDGGFMMNCQELETALRVGTNFVTLIFNDSGYGLIGWKQMNHFGASSFIE
FGNPDFVKFADSMGLKGYRVESVADLIPTLKEAQSQNVPTVIDCPVDYRENVKFSKKAGE
LICRI
Download sequence
Identical sequences K9YDB6
gi|428777271|ref|YP_007169058.1| WP_015226717.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]