SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777274|ref|YP_007169061.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777274|ref|YP_007169061.1|
Domain Number 1 Region: 7-173
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.2e-39
Family Phosphoglucomutase, first 3 domains 0.0016
Further Details:      
 
Domain Number 2 Region: 258-386
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-26
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 
Domain Number 3 Region: 161-272
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.9e-22
Family Phosphoglucomutase, first 3 domains 0.0023
Further Details:      
 
Domain Number 4 Region: 391-478
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 3.4e-21
Family Phosphoglucomutase, C-terminal domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777274|ref|YP_007169061.1|
Sequence length 481
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I [Halothece sp. PCC 7418]
Sequence
MPFTPAPIQFGTDGWRGVIAADFTFARVCHLAPIAAQVLSESYSHLAENRLVIVGYDRRF
LAEQFAQAAAEAVQAAGFDVYLANTYAPTPALSWAVKANSALGALVLTASHNPAEYLGLK
VKGAFGGSVTRELTAKIESRLLSSETPSTETQGELERFNPWDSYAQVLASKVDLDRIQDA
IKQGKLGIFADVMHGAAAGGLSRFLGEGVIEINGDRDPLFGGNPPEPLPAYIPDLFRAIN
QAKQRNQYPLRVGLVFDGDSDRVAAVDGEGNFLSSQVLIPILIQHLVQHHGFSGEVVKTV
SGSDLIPLIAQQYQQPLYETPIGYKYIAERMLETPVLVGGEESGGIGYGTHIPERDALLS
ALYAIEAVVVAEKDLGRLYQDLQAQVRFSSAYDRIDLPLANEEAKQRVQTMLDADPPNQI
AERTVTSCQTVDGYKFRLEDNSWLLVRFSGTEPLLRLYCEATDQPSVRTILNWAKQWASS
L
Download sequence
Identical sequences K9YED1
WP_015226720.1.10129 gi|428777274|ref|YP_007169061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]