SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777430|ref|YP_007169217.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777430|ref|YP_007169217.1|
Domain Number 1 Region: 301-502
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.88e-46
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000522
Further Details:      
 
Domain Number 2 Region: 811-1032
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.81e-43
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000123
Further Details:      
 
Domain Number 3 Region: 140-186,279-335
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.17e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.001
Further Details:      
 
Domain Number 4 Region: 569-673
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 3.14e-27
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0002
Further Details:      
 
Domain Number 5 Region: 43-133
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 7.85e-22
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00015
Further Details:      
 
Domain Number 6 Region: 727-811
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 3.66e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00039
Further Details:      
 
Domain Number 7 Region: 188-277
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 6.28e-21
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777430|ref|YP_007169217.1|
Sequence length 1068
Comment hydrophobe/amphiphile efflux-1 (HAE1) family transporter [Halothece sp. PCC 7418]
Sequence
MPIFSIANTFIKRPILTTVCTLLILLVGGVCIPLLPINYLPDISPIQIQVSSFYTGADVD
TVENTVTTILERDINGVENMDYMTSQSYAGTSKISVLFPSNTDKSTNQVNVQNRVAQALP
KLPSSVQQLGVSTKAASTSILMIYGFYSEGGEYDNIFISDYVDLNVTDIIKRVSGVGDVA
VFGNKQNAMRLWLNPTALSARGLTILDVVNALRSQNIVVGAGAIGQEPVPEGQSYELPLR
IRSRFTNPKDFDNLVVKTGNDGTLVKLEDVGDVEIGAENYSSNALVNGQEGLGLAVYQSP
GSNALDVARNVQSTMAELNENFPPGMKAEIVYDTTSFIQTSIKEVFITLLQAIALVILVI
YCFLQDWRTTIIPAIAIPVALIGALAFALIFGFSINSLTMFGLILATGVVVDDAIVIVEA
VSGKLEQGLSAKEASMAVMKEMTGAVVSTSLVLLAVFIPVAFFPGTTGKLYQQFALIIAF
AIVVSTFNALSFSPSMSAILLRPQQESRGPLGWFFGKFNQFLAGLRDRYQGLVAFFIRIR
YLVMAAFVAALFGTYYMFQAVPSGFVPAEDQGVVLGLIQAPDGVSLSYTDQVVAEVGEIM
GEIPEIEGSFIASGNGFEGAGPNQGLFFAKLKPWGERTNEEQKINGILRRLNIAFSQIDS
AIVAAFNPPAIPGFGTTGGFELMLQDRTGGKLSIDEFLGNAQEILGNANQKPAIGGSAYT
QFTAGTPQLQVEFDRNKLESLNIDFQQAVQTLGATMGSQYVNDFVLGTRSYKAYVQAQGN
YRNSPQDIKKLYVRSRDGNMIPMSELATITPITGPQTITHYNGYRSIKLQGSPAPGYSSG
QAIAAMDETVEASALPGINSNWIGLAKEEIAAGSLGILVFLFGIIMVFLTLSAQYESYVD
PIIILLSVPLAMLGSLLFLSMRGLVNDVYANVALVMLIGLASKNAILIVEFANQARMEGL
SIVKAAQKAAGERFRPILMTAISSLVGFFPLVIATGAGSASRWSIGTALFGGLLVATVLS
LLIVPVLYVVIKSLESHFLDSNPPAQVNGSQLANLSDASEEEQAAFRS
Download sequence
Identical sequences K9YFX7
WP_015226876.1.10129 gi|428777430|ref|YP_007169217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]