SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777466|ref|YP_007169253.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777466|ref|YP_007169253.1|
Domain Number 1 Region: 128-346
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.43e-56
Family ATP-binding domain of peptide synthetases 0.00015
Further Details:      
 
Domain Number 2 Region: 3-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.49e-34
Family D-Alanine ligase N-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777466|ref|YP_007169253.1|
Sequence length 349
Comment D-alanine--D-alanine ligase [Halothece sp. PCC 7418]
Sequence
MSKLRVGLLFGGCSGEHEVSIRSASAIAQALQMEENSHKYEVIPVYIQENGIWKAGELAD
QVLKQQTPSALQASGERWDLPAVASTIDVWFPILHGPNGEDGTVQGLLKLMQVPFVGSGV
LGSAVGMDKLAMKTAFAQAGLPQVKYKGIQRDKVWSSPCVFPKLCDEIEEEIDYPCFVKP
ANLGSSVGISKAKTRSELETALDEAANYDRRIIVEQGIVAREVECAILGNEYPQASVIGE
ISYTTDFYDYETKYTEGKAELYIPAPLPDKIFKAVQELAKQAFTAVDAAGLARVDVFYEE
STGQVYVNEINTLPGFTVTSMYPRLWEATGIPFPQLVDRLIQLGLHHHQ
Download sequence
Identical sequences K9YDT9
WP_015226912.1.10129 gi|428777466|ref|YP_007169253.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]