SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777485|ref|YP_007169272.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777485|ref|YP_007169272.1|
Domain Number 1 Region: 25-311
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.71e-79
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000214
Further Details:      
 
Domain Number 2 Region: 299-401
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.2e-16
Family Tyrosyl-tRNA synthetase (TyrRS), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777485|ref|YP_007169272.1|
Sequence length 402
Comment tyrosyl-tRNA synthetase [Halothece sp. PCC 7418]
Sequence
MSSDFNWLYRGTTEIFPNQPDSDHPNENLEQRLLQSETPLRVKLGIDPTGTDIHLGHSIP
VRKLRAFQDAGHTAVLIIGDFTAQIGDPTGKSEVRKHLTPKEVEANAKTYLDQLRPILDF
DTPGRLEIRYNSEWLKDLDLSQILELLATMTVGQMLAKEGFAERYEKDQPIYLHEFMYPL
MQGYDSVAVEADVELGGTDQKFNIAVGRDLQRYFKKRPQFGLLTPILIGTDGVQKMSKSL
NNYVGLKEDALSMYSKLEKVPDDQIKTYFELLTNLPLDQLPENPRDCQKLLGLEVTTHYH
GKDVAEQAQKSALSLVSGQTGEAAAVPEYSLAEIEFPVKLFYLLNRTGLCASSGEGRRQI
KGGAVRLNGEKVTDINAEFEAADELTGKTLQVGKKKFVRLVA
Download sequence
Identical sequences K9YG44
WP_015226931.1.10129 gi|428777485|ref|YP_007169272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]