SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777491|ref|YP_007169278.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777491|ref|YP_007169278.1|
Domain Number 1 Region: 163-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.47e-70
Family Extended AAA-ATPase domain 0.0000000433
Further Details:      
 
Domain Number 2 Region: 421-624
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.26e-60
Family FtsH protease domain-like 0.0000037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428777491|ref|YP_007169278.1|
Sequence length 632
Comment membrane protease FtsH catalytic subunit [Halothece sp. PCC 7418]
Sequence
MKKTFGAKPHRKRISRYFLPLATGWMILQSVFLPSPTLAQNKSNELSYSQFLQKIEQGEV
ERVELDPRANSAIVEIIGESGETVKREVQLFDENSALITRLRDSKIPIDVEASDNNAETA
SIIANGVLILLLIGGLALIIRRSAKASGQAMSFGKSRARYQVEDQTGVRFDDVAGIDEAK
EELQEVVTFLKETERFTAVGAKIPKGVLLVGSPGTGKTLLAKAVSGEAGVPFYSISGSEF
VEMFVGVGASRVRDLFKKAKENAPCLVFIDEIDAVGRKRGAGVGGGNDEREQTLNQLLTE
MNGFEENAGVIVIAATNRPDVLDPALMRPGRFDRQITVDLPSYKGRLGILDVHSRNKKLD
PDVSLEAIARRTPGLSGADLANLLNEAAILTARRFKETITMLEIDDALDRITIGLSLNPL
LDSKKKRLIAYHEVGHALLMTLLEHSDPLNKVTIIPRAGGVGGFAQQNFNEDMVDSGLYT
RAWIIDRITITLGGRAAEKEIFGDAEVTAGASNDLKVVSNLAREMVTRYGMSDLGPLALE
SQNDQVFLGRGDANQHNEYSEEVATKIDQQVRAIALRCYEKARQMIRENRALIDHLVDLL
LYEETIEGEEFRKIVSQYTQLPKKQLVSSGNQ
Download sequence
Identical sequences K9YDW4
WP_015226937.1.10129 gi|428777491|ref|YP_007169278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]