SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777519|ref|YP_007169306.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777519|ref|YP_007169306.1|
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000000000419
Family TTHA0281-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777519|ref|YP_007169306.1|
Sequence length 68
Comment hypothetical protein PCC7418_2963 [Halothece sp. PCC 7418]
Sequence
MNYTIEIEEEEDGRIIGEIVELPGVLVYGETREEVVHKVQALALRVIADRLEHEEEASPL
LNLSFVAP
Download sequence
Identical sequences K9YF31
WP_015226965.1.10129 gi|428777519|ref|YP_007169306.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]