SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777639|ref|YP_007169426.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777639|ref|YP_007169426.1|
Domain Number 1 Region: 88-377
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.06e-62
Family Alanine racemase-like, N-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 458-600
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000178
Family Eukaryotic ODC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777639|ref|YP_007169426.1|
Sequence length 672
Comment arginine decarboxylase [Halothece sp. PCC 7418]
Sequence
MSVQPQSFSSLEQNTESENHSSSSQSWTIEDSEQTYQIQGWGDPYFSINRAGHITVSPQG
DRGTSLDLYELVTALRKRNIGLPILIRFPEILADRVERLYACFDRAISRYNYQGSYRGVF
PIKCNQHRHLVESLVKCGTPHQLGLEVGSKPELMIALATLNPLQISEKEAQSSLLICNGY
KDREYIETALLSRRLGYETILVVEQLEELELIQAISEELAIYPAIGIRAKLGTRGTGRWG
SSTGDRAKFGLTIWQILQAVETLKSYNKLDCLQLLHFHIGSQVSSIRVIKEAIREAAQIY
VELTNLGANLNYLDVGGGLAVDYDGSKTQKNNASKNYNMQNYANDIVAEVKEACDQAEIK
VPTLISESGRAIASHQGVLIFDVLGSNEPPVTPPPVIEEEEHLIIRNLWETYALINEENY
QEYYHDAIQFKQEAISLFNFSYLSLKERARAEQLYWACCAKVFEIIKHQETINEELQSIA
NILTSIYYINLSIFQSAPDHWAIDQLFPIMPIHRLNEPPSKRAILADLTCDSDGKISQFI
NPKGQKPKDFLELHPLDNNQPYYLGMFLVGAYQEIMGNLHNLFGDTNVVHIRTHGKGYKI
EQLVRGDTITEVLAQTQYSSEELLENLRRHTEQALEKNLISLAESRRLLNNYQQGLANYT
YLKANDQESCIP
Download sequence
Identical sequences K9YFG4
WP_015227084.1.10129 gi|428777639|ref|YP_007169426.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]