SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777651|ref|YP_007169438.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777651|ref|YP_007169438.1|
Domain Number 1 Region: 298-500
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 9.02e-49
Family Multidrug efflux transporter AcrB transmembrane domain 0.00000285
Further Details:      
 
Domain Number 2 Region: 808-1028
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB transmembrane domain 2.22e-45
Family Multidrug efflux transporter AcrB transmembrane domain 0.0000102
Further Details:      
 
Domain Number 3 Region: 567-671
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 2.88e-33
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.00028
Further Details:      
 
Domain Number 4 Region: 138-183,276-332
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 5.23e-29
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0017
Further Details:      
 
Domain Number 5 Region: 39-131
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 1.1e-26
Family Multidrug efflux transporter AcrB pore domain; PN1, PN2, PC1 and PC2 subdomains 0.0000889
Further Details:      
 
Domain Number 6 Region: 723-808
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 9.68e-23
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00052
Further Details:      
 
Domain Number 7 Region: 184-274
Classification Level Classification E-value
Superfamily Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 4.32e-20
Family Multidrug efflux transporter AcrB TolC docking domain; DN and DC subdomains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777651|ref|YP_007169438.1|
Sequence length 1068
Comment hydrophobe/amphiphile efflux-1 (HAE1) family transporter [Halothece sp. PCC 7418]
Sequence
MFVNYFIKRPVFATVCSLIVLIVGVICIPLLPVAQYPDISPKQVSVRATYTGADAKTVEE
TVTTVLEREINGIDGMRYMSSSSTNSGVSSITVTFEASRNQDIAAVDVQNRVSQAEPSLP
QPVIQNGVEVSKESNTILMGFGLFSENDQYDNIFLSNYADLYLVDALERVEGVGNVQIFG
ERKYAMRIWLNPDRLASRNLVAQDVIDALQEQNIQVGAGQVGQPPVPGDQRFQISLRADT
RLETVAEFEDLIISTQDNGTLIKLKDVGRAELGAQDYSSFLRFRGNEAVGLGIYQQPGSN
ALDVARGVKARMKELSQEFPSGMSYDIGFDTTDFVQQSMISVVQTLLQAVVLVILVIYVF
LQDWRTTLIPAITIPVSLIGTFAFVKLFGFSINSLTLFGITLATGMVVDDAIIVVENISR
KIQDDAYPPAQAAMVAMRELTGAVIATSLVLMAVFIPVAFFPGTTGALYRQFALTIAFAI
AVSTFNALTLTPTLSGLLLRQKMPSQGVLAIAFGWFNNFLGALERGYRGLIIFFGRIKFF
ILAGFVALLVLTGWVYQQVPKAFLPQEDQGYFITIVQGPEGASLQYTSDVMEQIEQYYLN
IPEVRATFAVGGFAFGGNTPNQGVIFTPLIPWSERTQPSQSVSAIINQVRGKLMSLPEAN
VFPVNPPAIRGLGSFGGFQFQLQDRRGNLDINEFVNSMGPLLGAANQHPDIAGAFSRFAA
NTPILELNVDRDRAKALQVDINDIFNTLQTYFGSRYVNDFTMNRRNYRVYVQADGQFRDN
PEEINQLYVKSNNDQMIPLGNLVSVTETIGAQSINHYNGFRSIEINGEAAPGSSSGEALA
AMEQAAAQTLAPGLGYEWSGTSLEQIQSGGQAPLIFGLGLVFVFLVLAAQYESYVDPMII
MMSVPLAVLGALTAQSLRGLSNDIYTQIGLVMLIGLASKNSILIVEFANQLRELGLTITQ
SAIVAAQKRLRPIIMTAISTLSSIFPLVIASGAGSASRQSLGTAVFGGMFVATFLSLFVV
PILYMIIKTLGERVFGERYPQQGETSLSAITTSEKVTPSVHETDGKIG
Download sequence
Identical sequences K9YEF3
gi|428777651|ref|YP_007169438.1| WP_015227096.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]