SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777773|ref|YP_007169560.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777773|ref|YP_007169560.1|
Domain Number 1 Region: 385-932
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.74e-116
Family Amylase, catalytic domain 0.0000000144
Further Details:      
 
Domain Number 2 Region: 936-1039
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 9.35e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0049
Further Details:      
 
Domain Number 3 Region: 160-276
Classification Level Classification E-value
Superfamily E set domains 3.78e-20
Family E-set domains of sugar-utilizing enzymes 0.0013
Further Details:      
 
Domain Number 4 Region: 275-384
Classification Level Classification E-value
Superfamily E set domains 1.86e-18
Family E-set domains of sugar-utilizing enzymes 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777773|ref|YP_007169560.1|
Sequence length 1039
Comment alpha-1,6-glucosidase [Halothece sp. PCC 7418]
Sequence
MASLGGLPPFGSIWKRLVVLSLISFLLIWSQPACADSNSPLNWVGNMFPSGNSNIILPKG
ENFSVYTQVYKQGVTASYGRGEDIACTLYWGEVERFGGAWQTVMTTPMSYIGDANDNDEY
RGVIAPETGLYEYTTRCAEETTSTVRWQSGGNGRLTVSPVPNAPEQRSAMWIDHHNIAWN
QDQAATYELHYAPNGNLMVPVRSGDGIQLKNEKTLTWDTNSKFPHIDGYQDLEVPSAARP
LVPAIVKSETAIAAYDKSGKLIEATGIQLQGVLDDLYSYSGDLGVIYNQGTPTLKVWAPT
AKSVTLHRFENPRPNTKATTHEMTFDPETGVWSVVGDRSWDQQYYLYEVEVYVPFTGKFE
KNFVTDPYSVNLSQDSRLSQMVDLYNDPSLKPDGWDDMIKARLDAPEDMAIYEAHVRDFS
RDDETVPERDRGTFNAFRYNGKNGKPLSNGMNHLQQLAEAGLTHLHLLPASDFASVEENP
KARINPDPDLLASFARDSVQQQAIIGSTRGNDSFNWGYDPYHYGVPEGSYATAQDGVNRI
LEFRRMVQSLNDIGLQVVMDVVYNHTFANGLYTQAVLDKVVPGYYHRYNKDGYQENSSCC
PDTATEFAMMEKLMVDTILRWAKAYKVDGFRFDLMNLHTVENLVSLRKTINDLTLDQDGV
DGESIYLYGEGWDFGSAKGKGLYAATQYNMAGTGIGTFNDKIRDAVHGGYSGNPQQIHQQ
GFINGESFDWNGYFYNKRFRNNLRTNSDKLRINLAGSLQDFKIIDQNNNQVSGIELQGAG
YTKDPQESINYISKHDNETLFDLNMFKLPLGKSGTAVTSMNERVRVQNLGLSLVGLSQGI
PFFQMGSDMLRSKSLDHNSYDSGDWFNRIDFTYSGNNFGVGLPPAWGNQERWGIMSPLLR
NTKFDPEKEHILDNVHHFQEILQIRRSSPLFRLRSKEDIEQRVKFHNMGQNQKDAFIVMS
LDDTVGENLDPNYNKVVALFNADKFGQKIKIPELAGTSMVLHPVQANSHDDVVKSANFNL
TTGEFEVPARTTAVFVAPE
Download sequence
Identical sequences K9YEG3
gi|428777773|ref|YP_007169560.1| WP_015227218.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]