SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428777868|ref|YP_007169655.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777868|ref|YP_007169655.1|
Domain Number 1 Region: 4-116,145-206
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.16e-40
Family Clp protease, ClpP subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777868|ref|YP_007169655.1|
Sequence length 275
Comment signal peptide peptidase SppA [Halothece sp. PCC 7418]
Sequence
MVWLIGKRRRKKIARIEITGAIASETRQRVLKALKTVEEQKWKALLLRIDSPGGTVGDSQ
EIYSALRKLQDKMKIVASFGNISASGGVYVGMGAEKIVANPGTITGSIGVILRGNNLERL
LDKVGVSFKVIKSGPYKDILSFDRELTDEEKHILQALIDTSYHQFVRTVAEARSLSLETV
QSFADGRIFTGEQAQELGVVDRLGSEEDARRWLAELVDLDPDKTKCVTIGENKSPLQRFL
PGQNQSDTNLTWKTATDWLEFELATNGQPLWLYRP
Download sequence
Identical sequences K9YEQ6
WP_015227313.1.10129 gi|428777868|ref|YP_007169655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]