SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777944|ref|YP_007169731.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777944|ref|YP_007169731.1|
Domain Number 1 Region: 47-226
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000194
Family GAF domain 0.011
Further Details:      
 
Domain Number 2 Region: 279-471
Classification Level Classification E-value
Superfamily PP2C-like 0.00000981
Family PP2C-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428777944|ref|YP_007169731.1|
Sequence length 475
Comment serine phosphatase [Halothece sp. PCC 7418]
Sequence
MSNPMTALPARDPSSENNGFEAKLAQPETPVSTLKELVANLRREQNKVQNLLSSLGFALR
SFNNLNQFLEIIPLMAARVSDADGSAILLYKGEGKVSVEQVHCQGGLACKDIRYRLLQVT
RTLGKNITEAGGGTTTLDQKIAKALPEDIQLFGTPILVQGKERGKVYIFTRDRAYDWTLS
RQKLVQLVADQAAVAIANNDLAVEVRQKEKLDRELEVATDIQCHLFPRKYPKIKGLDIAA
ACRTANRVGGDYYDFIPANYDQPQSESEAEDQTGSTVPWSIVIGDVMGKGVPAGLIMTMT
RGMLRAEVLNHHSPAQILEHLNRVMYDDLESSHRFVTLFYSQYDPKTRCLSYSNAAHNPP
LWWQAKTNTVHRLDTLGMLVGLDTDSQYEEASVQLDIGDTVLYYTDGFTDAVNAKGQRFE
EENLIRSFHDAAAQHYSPEAIVEHLFASVQAFIGEKKRSIDDMTLVVMQVKDEGV
Download sequence
Identical sequences K9YG97
gi|428777944|ref|YP_007169731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]