SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778025|ref|YP_007169812.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778025|ref|YP_007169812.1|
Domain Number 1 Region: 21-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.56e-65
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000391
Further Details:      
 
Domain Number 2 Region: 213-386
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.5e-64
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000229
Further Details:      
 
Domain Number 3 Region: 396-595
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5e-62
Family Pyruvate oxidase and decarboxylase PP module 0.0000137
Further Details:      
 
Weak hits

Sequence:  gi|428778025|ref|YP_007169812.1|
Domain Number - Region: 601-623
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.051
Family NOB1 zinc finger-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778025|ref|YP_007169812.1|
Sequence length 625
Comment acetolactate synthase large subunit [Halothece sp. PCC 7418]
Sequence
MGYPNQSQQIATPSQTKTPEVPQKCTGAFALMDSLKRHGVTHIFGYPGGAILPIYDELHR
SEARGDVKHILVRHEQAAAHAADGYARATGKVGVCFATSGPGATNLVTGLATAHMDSIPM
VAITGQVARPAIGTDAFQETDIFGITLPIVKHSYVVRRASDMARIVAEAFHIASSGRPGP
VLIDIPKDVGFEECDYVPVLPNQVNLPGFRPTQKGNPRKVLEAIRYIESAERPLLYVGGG
AITSGAHEEIQQLAEHFQIPVTTTLMGLGSFDENHPLSVSMLGMHGTAYANYAVSECDLL
IAVGARFDDRVTGKLDEFASKAKVIHIDIDPAEVGKNRAPNVPIVGDVRTCLQQILDRVR
ELDIPAQSGRTQPWLKKIQRWREIYPLVVPHYEDLLSPQEVIVEVGQQAPYAYYTTDVGQ
HQMWAAQFIQYGPRRWISSSGLGTMGYGLPAAMGVKAGVGDEQVICISGDASFQMNLQEL
GTLAQYGINVKTVLINNGWQGMVRQWQQTFFQERYSASNMQVGMPDFEKLCEAYGIKGML
LRDRADLSTAITEMLNHDGPVLLDAQVKKDENCYPMVAPGKSNAEMLGLPELKQLDQAVE
IMYCSNCRAKNPATNKFCPECGTKL
Download sequence
Identical sequences K9YHM5
gi|428778025|ref|YP_007169812.1| WP_015227470.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]