SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778028|ref|YP_007169815.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778028|ref|YP_007169815.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily PEBP-like 6.67e-44
Family Prokaryotic PEBP-like proteins 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428778028|ref|YP_007169815.1|
Sequence length 143
Comment phospholipid-binding protein, PBP family [Halothece sp. PCC 7418]
Sequence
MKLTSPVFENNGIIPQKYTCQGNNINPPLMIRNIPNGTVSLALIIDDPDAPMKTWDHWVM
WNIKPVAEIPENSALGEQGKNSWGNNHYGGPCPPNGTHRYFFKLYALDCDLNLSRKATKL
DLEAAMENHILESVNLIGLYQKV
Download sequence
Identical sequences K9YF59
WP_015227473.1.10129 gi|428778028|ref|YP_007169815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]