SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778112|ref|YP_007169899.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778112|ref|YP_007169899.1|
Domain Number 1 Region: 111-287
Classification Level Classification E-value
Superfamily alpha/beta knot 1.77e-43
Family SpoU-like RNA 2'-O ribose methyltransferase 0.0000363
Further Details:      
 
Domain Number 2 Region: 40-120
Classification Level Classification E-value
Superfamily L30e-like 3.3e-19
Family RNA 2'-O ribose methyltransferase substrate binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428778112|ref|YP_007169899.1|
Sequence length 300
Comment TrmH family RNA methyltransferase [Halothece sp. PCC 7418]
Sequence
MSEKPRKGKPKPKGKKPFPVSRRPKIKQPTTPQPEEKTTENTENDDLIYGRHTVQAALEG
HRQLNRIWITPRLRYNSTFNPLLQTAKKQGSIIDEVGVERLNQITHGANHQGVAAQVAPY
PYWELAELIEKAQAVTDKPIIIAAEGITDPHNLGSIIRSAEALGAQGIVIPQRRAAGITS
TVMKVAAGALEYLPVARVVNFSRGLEELKKAGFWVYGTVAEEGQLISQVSFDHSVVLVVG
GEAQGLNLLTQRHCDELVTIPLFGKTESLNAHIASAIALYEVSHRRQKKTLNLSEGSSKN
Download sequence
Identical sequences K9YH39
WP_015227557.1.10129 gi|428778112|ref|YP_007169899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]