SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778198|ref|YP_007169985.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778198|ref|YP_007169985.1|
Domain Number 1 Region: 138-477,506-581
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.91e-135
Family Amylase, catalytic domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 7-151
Classification Level Classification E-value
Superfamily E set domains 1.26e-44
Family E-set domains of sugar-utilizing enzymes 0.0038
Further Details:      
 
Domain Number 3 Region: 596-706
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000000264
Family alpha-Amylases, C-terminal beta-sheet domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428778198|ref|YP_007169985.1|
Sequence length 718
Comment isoamylase [Halothece sp. PCC 7418]
Sequence
MNLDVWPGKPSPLGATWDGEGVNFAIFSENATEIELCLFTGQDHEIRLPLKEVHNYVWHG
YIPGLQPGQRYNYRVHGDYRPKQGHRFNRKKLLLDPYAHGIMGDIGYGEEIFAYPWDAEE
KDLACSNTDDSHLIPKCIVTNNFFDWEGDQLLQTPWHETIIYEVHVKGFTQQHPKIPQHL
RGTYAGLAHPTAINHLKSLGITAVELLPVHHFLASPGHLVNKGLRNYWGYDSVGYFAPYS
GYSASGSGGEQVKEFKGMVKALHQAGIEVILDVVYNHTGEGNHFGPTVCFRGIDNSAYYR
LVDDDPRYYMDFTGCGNSLNVRHPQILKLIMDSLRYWVQEMHVDGFRFDLASALARELYE
VNSLAAFFDIIHQDPILSNVKLIAEPWDVGEGGYQVGNFPLLWSEWNGKYRDTVRDFWRG
EEHTLTEFAYRFTGSSDLYQANGKLPHASINFITAHDGFTLRDLVSYNEKHNHANGENNH
DGEDYNRSWNWGAEGETDDPEILQQRSRQQRNLITTLMLSQGVPMLLGGDEMGRTQQGNN
NAYCQDNELTWFNWELSPENEELLAFTKEIIAFRHQHPVFHRRNWFQGRAIHGSQVSDLG
WYHPDGSFVTEQQWLENQLTKAITVFLNGQELSAPNPRGKRLVDDSFLLFFNSDDQQRVF
ILPQALQKWVWQVVIDTNQPQLLSGEIAYTGEEEIPLNPFSLLVLKSHQFQESIQSIQ
Download sequence
Identical sequences K9YFP0
WP_015227643.1.10129 gi|428778198|ref|YP_007169985.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]