SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778315|ref|YP_007170102.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778315|ref|YP_007170102.1|
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily Ava3019-like 2.48e-37
Family Ava3019-like 0.0000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778315|ref|YP_007170102.1|
Sequence length 136
Comment hypothetical protein PCC7418_3784 [Halothece sp. PCC 7418]
Sequence
MELTQARKLLDQYSCTEQKTVKTEQEKQDLQTALKQITQESEWENLGICADNTEQAITAL
KTYLTALGYDINQIDFNQVASVGSPVYIKFSTKQMGFYQDNYTGDYRGVLVSCQAEDDLI
AGVYGHLPLDLFTTTN
Download sequence
Identical sequences K9YIE9
gi|428778315|ref|YP_007170102.1| WP_015227759.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]