SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428778337|ref|YP_007170124.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428778337|ref|YP_007170124.1|
Domain Number 1 Region: 8-83,180-344
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.92e-45
Family Bacterial dinuclear zinc exopeptidases 0.0021
Further Details:      
 
Domain Number 2 Region: 73-188
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 0.000000000000013
Family Aminopeptidase/glucanase lid domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428778337|ref|YP_007170124.1|
Sequence length 348
Comment peptidase M42 family protein [Halothece sp. PCC 7418]
Sequence
MSEFNALFNTITELVLCHSPSGAEQEIDRALLEKFNAIGVENWQDEAGNIIAKIPGQQSD
SPVAITAHKDEIGTIVKCVREDGALEVRRLGGSFPWVYGEGVMDILGDRATISGILSFGS
RHVSHESPQKAQQEDQPLFWENAWIETKCSVEELETAGVRPGTRVVIGKHRKQPFRLNED
YIASYTLDNKASLAILLDLAQQIQNPPQDVYLIASAKEEIGAIGALYFTQNQRLGALIAL
EIIPLAPEYSFTGGEAPVLLSQDGYGFYDEGLNQEIVQAAKKADVPLQPAIIDGFGSDGS
IAMKMGHVSRAACLGFPTDNTHGYEIAHLSAIAHCTKILAHFATSPQF
Download sequence
Identical sequences K9YHP0
gi|428778337|ref|YP_007170124.1| WP_015227781.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]