SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428774965|ref|YP_007166752.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428774965|ref|YP_007166752.1|
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily L28p-like 2.16e-25
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428774965|ref|YP_007166752.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Halothece sp. PCC 7418]
Sequence
MSRRCQLTGKKANNAFAISHSHRRTKKLQNVNLQTKRVWWPEGNRWVKLTLSTKAIKTLQ
KKGLQKMADEMGINLNQA
Download sequence
Identical sequences K9Y8W9
WP_015224416.1.10129 gi|428774965|ref|YP_007166752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]