SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428777086|ref|YP_007168873.1| from Halothece sp. PCC 7418

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428777086|ref|YP_007168873.1|
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-28
Family ABC transporter ATPase domain-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1-52,774-990
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-19
Family ABC transporter ATPase domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 451-549
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 1.09e-16
Family Rad50 coiled-coil Zn hook 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428777086|ref|YP_007168873.1|
Sequence length 1005
Comment exonuclease SbcC [Halothece sp. PCC 7418]
Sequence
MIPQQLILSNFLSYQQATLDFTGLHTACICGANGAGKSSLLEAITWALWGKTRTTSDEDV
INSTAKEVQVDFRFQCNGDTYRVLRGRRRGQSASLELQVQHQNQFQSLTAKGVKATQKKI
NELLKLDYDTFINSAYLRQGRADEFMQRSPTERKKLLAELLKLDQYQDLSEEAKDISRKL
KGQSEQLEQTLAPTEKELEQKTTIAQSLAEVEAKYQALQEKQEADQTELQRLQTLDSQRK
TKQEQIDWYNQQYQTIAQDYQKLTQEQQKIQQSLSELNQLLERETEIKQAYQTYLDLQKE
QESLAKKFETYQDLTQRSQQIKEQQQKQINDFKLQKQRIETELENLTAQEESAQKTLQKA
DEIKEEVAKLNAARERLKELDQLQQEVSPLMQRRQTLQLEVDREGERKKARLEQIESNLK
ELQAELAQFPEREKEYNSIIDRLKELEKKETYSQRLQEKRQKQQELQARLQQTEKTYEKQ
LEDLVKKLELLQNPEANCPLCERPLDDEHKQRVTHKTQQEYQSIEAEKATVWEDLAKSKR
ELDHYSQEYETLTQELAEHDELVARRGQLESYFDEDVCNIHEKISNLNREKRDIQEILDQ
ETYAQEKQAELQNIEQRLAEINYDEKTHAIAREKVDSLRYADRKAEQLADAKKEVEKINQ
RKPELEQSRTKIQEQITEMETSFSEQLQTIDQEIEDLGYARSRHNEVITQVQEAQKSQLN
YQKLEQAKAEFPQKQAELTEINQRLQSREKEKADCQQQLDALNEEIKKVTDVRTEIKQLE
QKTQQQRQQLDSYLSEKGKLEQRLNYLEELKTKYQDSKEKLKTLKRKETVYKELSQAFGK
NGIQALMIENILPQLEATTNQILSRLTGNQLHVQFLTQKASKGRSKKQTKLIDTLDIIIA
DAQGTRAYETYSGGEGFRINFAIRLALAKLLAQRAGTALQLLIVDEGFGTQDSHGCERLI
AAINAIAPDFCCILAVTHMREFKEAFQHRIEVTKTDQGSQITVSS
Download sequence
Identical sequences K9YCR6
WP_015226532.1.10129 gi|428777086|ref|YP_007168873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]