SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|262396314|ref|YP_003288167.1| from Vibrio sp. Ex25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262396314|ref|YP_003288167.1|
Domain Number 1 Region: 558-1034
Classification Level Classification E-value
Superfamily ALDH-like 6.68e-126
Family ALDH-like 0.000000431
Further Details:      
 
Domain Number 2 Region: 190-532
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.28e-116
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000279
Further Details:      
 
Domain Number 3 Region: 17-188
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.31e-63
Family N-terminal domain of bifunctional PutA protein 0.0000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262396314|ref|YP_003288167.1|
Sequence length 1043
Comment proline dehydrogenase (Proline oxidase)/delta-1-pyrroline-5-carboxylate dehydrogenase [Vibrio sp. Ex25]
Sequence
MFTATNVLTPEFIGQPLDKLWSLISPLYMVDESQWLEQLLPLATPTEDEKSAITTQTTQL
IEAIRADKKSIQMIDALLLEYSLDTQEGILLMCLAEALMRIPDAATADSLIKDKLSVADW
KSHLKNSDSVFVNASTWGLMLTGKVVGLGEQGTQSPGQAVNRLVNKFSEPVIRKAMYQAM
KIMGHQFVRGRTIEEAQKNGRPMRDKGFTYSFDMLGEAALTTADANKYFKDYLMAIEAVG
RETYGNDTSPAPSISIKLSALHPRYEVANEERVMTELYDSLMQLLKRAIEVDVAITIDAE
EADRLELSLKLFEKVYRSDLVKGWGKFGLVIQAYSKRALPVLVWLNALAKEQGDLIPLRL
VKGAYWDSEIKWSQQAGYANYPVYTRKEATDVAYLACARFLLSEGVRGNIYPQFASHNAH
TVTAIAVMAEHKEYEFQRLHGMGDSLYNHVMEMYGQPVRIYAPVGSHADLLPYLVRRLLE
NGANSSFVHRLVDARCPIYELTHHPVDVLTGFDTLHNDKIPLPADIFPERKNSYGVNIDI
DSEAKPFEAQVESFMDNQWVAGPMINGERFAESMIKENAAEIITAPYDRRIEVGKVAFAT
LDHVSAAIDAAQTAFSDWKGVPVEQKAACLEKLADLMEENLAELVAICHKEAGKTIHDSI
DEVREAVDFCRYYAKQAQNLQPFELEGFDGVKRISSREGLGVFVCISPWNFPLAIFLGQV
TAALIAGNTVVAKPAEQTSLIAARAIELMLDAGFPAGVIQLLTGRGAEIGHALTSHDAIA
GVAFTGSTATAQRINVTLAERSAKPVPFIAETGGQNAMIVDSTALPEQVVRDVIRSAFAS
AGQRCSALRVLFVQEDVADRMINLIQGAMNELHVGLPYLHKTDVGPVIDSNAKQKLLAHL
EQMSKTQTKVAQLQLDESCQHGDFVSPSAFEISGIDVLKEEQFGPILHIVRFKASELPNV
VAQINKTGFGLTMGIHSRNETTYRWIEKHARVGNCYINRDQVGAVVGVQPFGGQGLSGTG
PKAGGPHYLFRFTQHLLAQAENA
Download sequence
Identical sequences A0A0T7E4Z3 A7JXP7
gi|262396314|ref|YP_003288167.1| WP_006740881.1.3237 WP_006740881.1.43605 WP_006740881.1.82618 150340.VEA_001017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]