SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|261417524|ref|YP_003251206.1| from Geobacillus sp. Y412MC61

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|261417524|ref|YP_003251206.1|
Domain Number 1 Region: 5-204
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.89e-57
Family Nucleotide and nucleoside kinases 0.0000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|261417524|ref|YP_003251206.1|
Sequence length 214
Comment thymidylate kinase [Geobacillus sp. Y412MC61]
Sequence
MPRVMNGCFFSFEGPEGAGKTTMISKLESLLRERGIDVVATREPGGVRIAEAIRSIILNR
DYTEMDGRTEALLYAAARRQHLLEKIVPALEAGCVVLCDRFVDSSLAYQGFARGLGIEEV
WKINEFAIDGYMPSLTIYFDIDPQIGLERIRRNRGREVNRLDLETLSFHEKVREGYRELA
RRFADRIVVIDANRPLDDVFAETTAAVLSRLKGR
Download sequence
Identical sequences A0A0E0T760 L7ZSG1 Q5L3W9
gi|448236333|ref|YP_007400391.1| 235909.GK0024 544556.GYMC61_0024 gi|261417524|ref|YP_003251206.1| gi|297528399|ref|YP_003669674.1| gi|56418559|ref|YP_145877.1| gi|319765181|ref|YP_004130682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]