SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283777787|ref|YP_003368485.1| from Citrobacter rodentium ICC168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283777787|ref|YP_003368485.1|
Domain Number 1 Region: 289-516
Classification Level Classification E-value
Superfamily Colicin 5.36e-84
Family Colicin 0.0000000477
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283777787|ref|YP_003368485.1|
Sequence length 516
Comment colicin [Citrobacter rodentium ICC168]
Sequence
MSGGDGTGHNSGAHNSGGNINGGSAGSGGNGGASDNSGWSSENNPWGGSNSGIHWGGGSG
SGNGGGEHGSQTGWGWSSTTNPDVPPYVDANGQVRITITNGLVKTPVYGVPEPGGKSDVQ
GGYIPGNPDDEVARKWDKSNLPREIEVNVDGFKYRVTLDDDGRAIGIIRTGVRPYVGSEK
AKAGIMEKINHKTPEEIYEALGFNKDEPQRQEKAKQKAKDAWEHLPPNVRSFDVDVAQFH
YSVVLDDYGDVLSVTRTAVRPYVGSEKAKAGIMEKINHKTPEEIYEALGFNTEEPQRQNQ
AKKAAQDVFNSFSMNRDRIQSDVLNKAAEVISDMGNKVGDYLGEAYKSLAREISDDIKNF
QGKTIRSYDDAMASLNKVLSNPGFKVNRADSDALANAWRSLDAQDMANKLGNISKAFKVA
DVVMKVEKVREKSIEGYETGNWGPLMLEVESWVLSGIASTVALGIFSATLGAYALSLGAP
AVAVGIVGILLAATVGAFINDKFADTLNNAIIKPAH
Download sequence
Identical sequences D2TV62
gi|283777787|ref|YP_003368485.1| WP_012908936.1.100188 WP_012908936.1.97068 gi|283777787|ref|YP_003368485.1|NC_013717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]