SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283784786|ref|YP_003364651.1| from Citrobacter rodentium ICC168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283784786|ref|YP_003364651.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 2.88e-30
Family YccV-like 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|283784786|ref|YP_003364651.1|
Sequence length 105
Comment hypothetical protein ROD_10281 [Citrobacter rodentium ICC168]
Sequence
MIASKFGIGQQVRHSLLGYLGVVMDIDPVYSLEEPSPDELAVNDELRAAPWYHVVMEDDD
GQPVHTYLAEAQLRSETQDEHPEQPSMDELAQTIRKQLQAPRLRN
Download sequence
Identical sequences D2TSZ6
WP_012905351.1.100188 WP_012905351.1.15646 WP_012905351.1.97068 gi|283784786|ref|YP_003364651.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]