SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283787126|ref|YP_003366991.1| from Citrobacter rodentium ICC168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283787126|ref|YP_003366991.1|
Domain Number 1 Region: 112-252
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.4e-31
Family PA2201 C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|283787126|ref|YP_003366991.1|
Sequence length 255
Comment hypothetical protein ROD_35361 [Citrobacter rodentium ICC168]
Sequence
MSENLQVRDSRRDKAYFDKWIHFLQKAVYETRKDIDSIPIQHRILSRLSRIHSYILTKCI
MKYGRGDPVSSFTDELKELVQIRKLFNEKFTCLTELGEQTKKMYSKLTLYIYYDFFCWLV
FLYCSGGKKSDFLEVLDLFGHKGEDALLDHVAVLLGDTNRSIASNNTLVYGKIYKPLLDV
ILASENDRPALMKKFVEGWYRSMKPAAWHGNDKSYEGVYYGYWCFEAALVVNLLNIDDSS
FKDNVYYPKDMIIKR
Download sequence
Identical sequences D2TQW0
gi|283787126|ref|YP_003366991.1| WP_012907583.1.100188 WP_012907583.1.15646 WP_012907583.1.97068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]