SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|283788331|ref|YP_003368196.1| from Citrobacter rodentium ICC168

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|283788331|ref|YP_003368196.1|
Domain Number 1 Region: 1-359
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.87e-110
Family FMN-linked oxidoreductases 0.0000000000445
Further Details:      
 
Domain Number 2 Region: 333-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.59e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000079
Further Details:      
 
Domain Number 3 Region: 460-518,556-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.97e-25
Family C-terminal domain of adrenodoxin reductase-like 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|283788331|ref|YP_003368196.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Citrobacter rodentium ICC168]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEHPDGAERLAAFYAERARHGVALIVTGGI
APAPSGVAVAGGAMLNDVSQVAHHRTVTDAVHDEGGKIALQILHTGRYSYQPQLVAPSAI
QAPINRFTPHALSHDEILGLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAQRTNQR
DDRWGGDYARRMRFAVEVVRAIRQRVGDDFIIIYRLSMLDLVENGSTFEETVQLAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSVPLVTTNRINDPQVAEAIL
ARGDADMVSMARPFLADAEILSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHESKMPVIPASRPKNLAVVGAGPAGLAFAVNAATRGHHVTLFDALGEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNQVVTAEDLLAFDEVILACGIEPRRPPIDGIDHAS
VLTYLEVLRDKAPVGNRVAIVGCGGIGFDTAMYLSQPGEATSQNIAGFCAEWGIDTTLRQ
AGGLRPEGAHLPRSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYQKI
DDEGLHVVINGEAQTLKVDNVIICAGQEPRRELAEPLRAAGKTLHLIGGCDVATELDARR
AIAQGTRLALAI
Download sequence
Identical sequences D2TR15
gi|283788331|ref|YP_003368196.1| WP_012908668.1.100188 WP_012908668.1.15646 WP_012908668.1.97068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]