SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170762085|ref|YP_001752423.1| from Ureaplasma parvum serovar 3 str. ATCC 27815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170762085|ref|YP_001752423.1|
Domain Number 1 Region: 24-156
Classification Level Classification E-value
Superfamily PEBP-like 1.57e-21
Family Prokaryotic PEBP-like proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170762085|ref|YP_001752423.1|
Sequence length 368
Comment hypothetical protein UPA3_0356 [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence
MVENKFLKQIKEGEQIKIEIKGLDKFNNFDEQNYGLNNISPQIRWSPVLETASYAVAIID
YEAVGGAPFVHWYALNIFEPELALNVANLGYANLYQGENSTSKHFSHSILDANYQTDIAN
NYFPPCPPNKSHKYEIKVYAVHHKLSTNRNNILYLDDFEAKLNEAKIIATGSTYVCAPQI
SFEDDKLIIGSLEHKHPYLFANCENEYHVIEDVIVTDINKNIYSENQLDNFKDLEQAKIK
IIDSSDALSYAVIITSNHLFKKFGRPVVNYAHVIEKKTNKRIKFNNSYKLNHAFSEISPS
KYDHLGNELLILEDKDANFESGLFTIHVFGLNKKIKYLNKIDSVANSISDLFEMISGSVI
SYKAKLFK
Download sequence
Identical sequences A0A1Z3LQB5 A0A2C9DYE9
gi|170762085|ref|YP_001752423.1| WP_006688649.1.13444 WP_006688649.1.15075 WP_006688649.1.25107 WP_006688649.1.27588 WP_006688649.1.48879 WP_006688649.1.69950 WP_006688649.1.72504 WP_006688649.1.74768 505682.UPA3_0356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]