SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170762107|ref|YP_001752312.1| from Ureaplasma parvum serovar 3 str. ATCC 27815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170762107|ref|YP_001752312.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily Ribosomal protein L20 4.45e-43
Family Ribosomal protein L20 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|170762107|ref|YP_001752312.1|
Sequence length 120
Comment 50S ribosomal protein L20 [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence
MRVKGGSVTRQRRKRWLEKAEGSWGTRNTSYRIARQTVIRAAEYAYRDRRNKKRDFRKLW
ISRINAAVRELGYTYSQFMNALVKANVVTKDGQGLNRKMLSELAINNPEAFNQLVDKVMK
Download sequence
Identical sequences A0A1Z3LQD3 B1AIL8 Q9PQR2
WP_006688834.1.13444 WP_006688834.1.15075 WP_006688834.1.21584 WP_006688834.1.25107 WP_006688834.1.48879 WP_006688834.1.69950 WP_006688834.1.72504 WP_006688834.1.74768 gi|13357789|ref|NP_078063.1| gi|170762107|ref|YP_001752312.1| 273119.UU229 505682.UPA3_0237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]