SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170762217|ref|YP_001752288.1| from Ureaplasma parvum serovar 3 str. ATCC 27815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170762217|ref|YP_001752288.1|
Domain Number 1 Region: 2-200
Classification Level Classification E-value
Superfamily DhaL-like 6.54e-41
Family DhaL-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170762217|ref|YP_001752288.1|
Sequence length 564
Comment DAK2 domain-containing protein [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence
MKTIKLDLFQKMLYAGAKILEIECEYINDLNVFPVPDGDTGSNMKTTTAGAIIAIKEIEI
SNFSQLAKIFSRGLLMNARGNSGVILSQIFRGFMDALNNDAYEVSIEQLKQAFNGAKEKA
YASVSTPIEGTILTVIRVINERISERQNFDSVEDLFAFVTKEAQIILERTPEMLPSLKEA
NVVDSGGYGLVSFLKGMYQSLTNTFDEKLIIKNEEENIKSKTKPLDLEIIHKEKEEGFGY
CSEIILSLRKKIIPNSPSKSFFEFEKYKSELAKIGDSIVAIQDEDLVKVHLHTLTPYKFL
QLSQKYGEFDKIKIENMTNQFYESLERKGLTTKKENKLTLSMEQKIIATVPSEKFKKMFI
EEHGIDNVIVTETEGAPSIQRFVDEINSTNSSQIFIVTDDSNIVLAAEQASKIVAENNIL
VSVIGAYNVFETLLAISHFEQQNDYRTNFKTMNKIVKKARSGMITTSIKNVKYPHITVNK
DDYIGIINKKIIASEKNAYDVLLKTIEMLIESLKKPEICYIYYGINASQTDVHQIEKYIS
EKYGIICDLRYTGQSLYHYYIGIQ
Download sequence
Identical sequences A0A2C9DYP5 Q9PQT6
gi|170762217|ref|YP_001752288.1| BSGCAIR30572 273119.UU207 505682.UPA3_0213 gi|13357765|ref|NP_078039.1| WP_006688935.1.15075 WP_006688935.1.27588 WP_006688935.1.48879 WP_006688935.1.72504 WP_006688935.1.74768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]