SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|170762378|ref|YP_001752086.1| from Ureaplasma parvum serovar 3 str. ATCC 27815

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170762378|ref|YP_001752086.1|
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ribose/Galactose isomerase RpiB/AlsB 5.36e-46
Family Ribose/Galactose isomerase RpiB/AlsB 0.0000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170762378|ref|YP_001752086.1|
Sequence length 154
Comment RpiB/LacA/LacB family sugar-phosphate isomerase [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence
MIKKIYFGNDHAAYEIKDQIITHLKQKGYQIIDEGAQAALGSVDYSTYALKVANDVVNDT
KNDSIGILLCGTGIGMNIAASKVHGTRVALVYNESSAKLAKEHNNANIITIGARENSLNQ
ILKMIDDFLTSKFLGERHQKRLDIIAKYEKEQNS
Download sequence
Identical sequences A0A1Z3LQW6 A0A2C9DZ31 Q9PRD9
WP_006688688.1.15075 WP_006688688.1.21584 WP_006688688.1.25107 WP_006688688.1.27588 WP_006688688.1.48879 WP_006688688.1.69950 WP_006688688.1.72504 gi|170762378|ref|YP_001752086.1| 273119.UU006 505682.UPA3_0006 BSGCAIR30569 gi|13357562|ref|NP_077836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]