SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162448095|ref|YP_001621227.1| from Acholeplasma laidlawii PG-8A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162448095|ref|YP_001621227.1|
Domain Number 1 Region: 402-699
Classification Level Classification E-value
Superfamily HAD-like 2.67e-46
Family Meta-cation ATPase, catalytic domain P 0.0011
Further Details:      
 
Domain Number 2 Region: 213-304
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 5.23e-23
Family Calcium ATPase, transduction domain A 0.0035
Further Details:      
 
Domain Number 3 Region: 166-208,306-390
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000222
Family Calcium ATPase, transmembrane domain M 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|162448095|ref|YP_001621227.1|
Sequence length 706
Comment P-type cation transporting ATPase [Acholeplasma laidlawii PG-8A]
Sequence
MKKNQFNSKSKHNHEHAMDDKHEHMNHHNHDDHNHHNHEHMNHHNHDDHNHHNHDDHNHH
KHHHHGNFKKIFLISLPLGLIVMWLSPFMGIHLPFPFYYEFKYSDILALFISIILFIYGG
KPFIQGAVTELKNKQPGMMALVTMGISVSFLYSVFAVVIRYVTGEHYMDFLFEFASLLLI
MLLGHWIEMLALMKAGDAQESLAKLLPKNALLLKEHGEMVEVPISQLKINDVIIVQSGEN
VAADGIILKGESRVNESLLTGESVPVVKKVGDFVIGGSTNEYSKLEVKVTKTGKDAYLSQ
VKNLIMDAQSKPSRAENNAKKVAGWLFYLALFAALVSFVVWYLMEDLNSAILFSITTLII
ACPHALGLAIPLVISRSTSIGSVNGVLVKDRQTYNLTTKADIVILDKTGTLTTGIFKVQH
IDLLDNSLTEEEVISILYGIESASSHPIAQSIIEYAKNKDIKALKFDKINYISGKGLEGS
VGLDTYEFISVNAYKEPITIQNDFGYTVSILLKNNKAIGVVKLGDSLKTSSQKLIKELKH
KGIRPIMATGDNEYAAKIVANKLDIEYYANQSPEDKYKLVDKFKKQGLIVIMMGDGINDA
PSLALADVGVAIGAGTQVAIDSADVILTNSEPGDIASFIDLSFKTNRKMNENLIWGAGYN
FIAIPIAAGILAPFGIILSPAIGGVLMSLSTVIVALNALTLNMVKS
Download sequence
Identical sequences A9NHM1
ABX81851 gi|162448095|ref|YP_001621227.1| 441768.ACL_1252 WP_012243182.1.46366 WP_012243182.1.71135 WP_012243182.1.72193 WP_012243182.1.92431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]