SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169627310|ref|YP_001700959.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|169627310|ref|YP_001700959.1|
Domain Number - Region: 568-599
Classification Level Classification E-value
Superfamily PEBP-like 0.0275
Family Phosphatidylethanolamine binding protein 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169627310|ref|YP_001700959.1|
Sequence length 662
Comment Conserved hypothetical protein [Mycobacterium abscessus]
Sequence
MSFAFGVAAALLLLFIPGWLIGRALGLPTHSAAVTAPALTYGLVGLCIVAFGSIGIPWNS
LSAGFALVGAVIIARLLWRWLRPKRQAEQTPSQNRAALVAVTFGVALGMALIFYAFLRGL
THWQSIPSTWDSMWHGNTIRYILDTGQASSTRMGDLRNVETHATLYYPSAFHGLAAVLCQ
LTGAAPTTSYTLYAVAGSLLFPLGSAALAWQMLRGRTTRTFQAGAAATAAALSASFSALP
YVEFHVSAIPNLMSFALVGPALLAITSVVADRSRIPAAILAFTGVASVHTSGAIVVVVFV
AAWWVLAPLSRYPGTKSKDKHRLGSGFTPLAVAGVGSLVLLYPQLRTLMQLSEIIAGHQF
TTPWGKKRALLDALTQHTRHLADYPVQSALLGLALIGAVVLIVKRVYWPVAVWLLLVIAI
VHSSKPFGGFVGHAVALFSDAFYSDPRRLSAIVCLLLAPAAGIGLFALAAAALATLRRAR
KTRADSRWTLVAAAIVLAAICGFSARHYFLPHKYLVGAKYDQVMVGPKKLDAFAYLATLP
GAKTTTIGDGNVDGSGWMYAVAGLHPLWTHYDFPQQQGPGYHRYIFWAYADDADTDRRVT
EAVHALNIRYVMTSTPVVQGFKVPDGLRSLDISRSWRKLYDNGAAQIYEWVGDRKPDAEG
DK
Download sequence
Identical sequences A0A1N0GY11 A0A2C9Y8R6 B1MEP1 X8DXY7
561007.MAB_0205c WP_005091102.1.100247 WP_005091102.1.100248 WP_005091102.1.100273 WP_005091102.1.10036 WP_005091102.1.100423 WP_005091102.1.10062 WP_005091102.1.100637 WP_005091102.1.101070 WP_005091102.1.10120 WP_005091102.1.101308 WP_005091102.1.101669 WP_005091102.1.101761 WP_005091102.1.101774 WP_005091102.1.102118 WP_005091102.1.10280 WP_005091102.1.10427 WP_005091102.1.1056 WP_005091102.1.10637 WP_005091102.1.10759 WP_005091102.1.10847 WP_005091102.1.1088 WP_005091102.1.10897 WP_005091102.1.11054 WP_005091102.1.1121 WP_005091102.1.1170 WP_005091102.1.12402 WP_005091102.1.12455 WP_005091102.1.12509 WP_005091102.1.1265 WP_005091102.1.12894 WP_005091102.1.1296 WP_005091102.1.13146 WP_005091102.1.13300 WP_005091102.1.13767 WP_005091102.1.14685 WP_005091102.1.14988 WP_005091102.1.15051 WP_005091102.1.15348 WP_005091102.1.15662 WP_005091102.1.15721 WP_005091102.1.16211 WP_005091102.1.1637 WP_005091102.1.16629 WP_005091102.1.16789 WP_005091102.1.16906 WP_005091102.1.16989 WP_005091102.1.16991 WP_005091102.1.1706 WP_005091102.1.17166 WP_005091102.1.17175 WP_005091102.1.17404 WP_005091102.1.17877 WP_005091102.1.1791 WP_005091102.1.18002 WP_005091102.1.18049 WP_005091102.1.18350 WP_005091102.1.18359 WP_005091102.1.18593 WP_005091102.1.18596 WP_005091102.1.18683 WP_005091102.1.18839 WP_005091102.1.19046 WP_005091102.1.19110 WP_005091102.1.1941 WP_005091102.1.19507 WP_005091102.1.19628 WP_005091102.1.19886 WP_005091102.1.19927 WP_005091102.1.20004 WP_005091102.1.20064 WP_005091102.1.20581 WP_005091102.1.2059 WP_005091102.1.20670 WP_005091102.1.21141 WP_005091102.1.21293 WP_005091102.1.21438 WP_005091102.1.2145 WP_005091102.1.21539 WP_005091102.1.21707 WP_005091102.1.2184 WP_005091102.1.22070 WP_005091102.1.22085 WP_005091102.1.23524 WP_005091102.1.23773 WP_005091102.1.2378 WP_005091102.1.2393 WP_005091102.1.24030 WP_005091102.1.24032 WP_005091102.1.24459 WP_005091102.1.24518 WP_005091102.1.24751 WP_005091102.1.24828 WP_005091102.1.2492 WP_005091102.1.25031 WP_005091102.1.25282 WP_005091102.1.25544 WP_005091102.1.25601 WP_005091102.1.2577 WP_005091102.1.25898 WP_005091102.1.26011 WP_005091102.1.26114 WP_005091102.1.26173 WP_005091102.1.26382 WP_005091102.1.27025 WP_005091102.1.27232 WP_005091102.1.27240 WP_005091102.1.27326 WP_005091102.1.27378 WP_005091102.1.27406 WP_005091102.1.27625 WP_005091102.1.27648 WP_005091102.1.27942 WP_005091102.1.28150 WP_005091102.1.28243 WP_005091102.1.28344 WP_005091102.1.28438 WP_005091102.1.28598 WP_005091102.1.28820 WP_005091102.1.29162 WP_005091102.1.29254 WP_005091102.1.29458 WP_005091102.1.29488 WP_005091102.1.29621 WP_005091102.1.29801 WP_005091102.1.30117 WP_005091102.1.30334 WP_005091102.1.30559 WP_005091102.1.30632 WP_005091102.1.30651 WP_005091102.1.30751 WP_005091102.1.30938 WP_005091102.1.31244 WP_005091102.1.31284 WP_005091102.1.31331 WP_005091102.1.31731 WP_005091102.1.31981 WP_005091102.1.32530 WP_005091102.1.32613 WP_005091102.1.32999 WP_005091102.1.33 WP_005091102.1.33117 WP_005091102.1.33462 WP_005091102.1.33577 WP_005091102.1.33858 WP_005091102.1.33863 WP_005091102.1.33998 WP_005091102.1.34101 WP_005091102.1.34687 WP_005091102.1.34752 WP_005091102.1.349 WP_005091102.1.34927 WP_005091102.1.34988 WP_005091102.1.35191 WP_005091102.1.35375 WP_005091102.1.35390 WP_005091102.1.35414 WP_005091102.1.35437 WP_005091102.1.35462 WP_005091102.1.35622 WP_005091102.1.36056 WP_005091102.1.36143 WP_005091102.1.36539 WP_005091102.1.36548 WP_005091102.1.36589 WP_005091102.1.36677 WP_005091102.1.36769 WP_005091102.1.36871 WP_005091102.1.37030 WP_005091102.1.3711 WP_005091102.1.37448 WP_005091102.1.37505 WP_005091102.1.37946 WP_005091102.1.38005 WP_005091102.1.38019 WP_005091102.1.38083 WP_005091102.1.38166 WP_005091102.1.38250 WP_005091102.1.38360 WP_005091102.1.38552 WP_005091102.1.38576 WP_005091102.1.38720 WP_005091102.1.38745 WP_005091102.1.38846 WP_005091102.1.38854 WP_005091102.1.39231 WP_005091102.1.39707 WP_005091102.1.39790 WP_005091102.1.39792 WP_005091102.1.39987 WP_005091102.1.40116 WP_005091102.1.4054 WP_005091102.1.4100 WP_005091102.1.4104 WP_005091102.1.41120 WP_005091102.1.41217 WP_005091102.1.41576 WP_005091102.1.4174 WP_005091102.1.41760 WP_005091102.1.41841 WP_005091102.1.41843 WP_005091102.1.41866 WP_005091102.1.42097 WP_005091102.1.42192 WP_005091102.1.42296 WP_005091102.1.42468 WP_005091102.1.42753 WP_005091102.1.42860 WP_005091102.1.43254 WP_005091102.1.43402 WP_005091102.1.43412 WP_005091102.1.43421 WP_005091102.1.43451 WP_005091102.1.4368 WP_005091102.1.43777 WP_005091102.1.43843 WP_005091102.1.43982 WP_005091102.1.44116 WP_005091102.1.4424 WP_005091102.1.44333 WP_005091102.1.44560 WP_005091102.1.45069 WP_005091102.1.45292 WP_005091102.1.45315 WP_005091102.1.4611 WP_005091102.1.4618 WP_005091102.1.46214 WP_005091102.1.46298 WP_005091102.1.46638 WP_005091102.1.4732 WP_005091102.1.47359 WP_005091102.1.47590 WP_005091102.1.48062 WP_005091102.1.48254 WP_005091102.1.48516 WP_005091102.1.4856 WP_005091102.1.4862 WP_005091102.1.48940 WP_005091102.1.49067 WP_005091102.1.49125 WP_005091102.1.49142 WP_005091102.1.49468 WP_005091102.1.49908 WP_005091102.1.50140 WP_005091102.1.50203 WP_005091102.1.50524 WP_005091102.1.50738 WP_005091102.1.50749 WP_005091102.1.51350 WP_005091102.1.51442 WP_005091102.1.52022 WP_005091102.1.52084 WP_005091102.1.52300 WP_005091102.1.52379 WP_005091102.1.52471 WP_005091102.1.527 WP_005091102.1.52718 WP_005091102.1.52925 WP_005091102.1.53301 WP_005091102.1.53591 WP_005091102.1.53644 WP_005091102.1.53890 WP_005091102.1.54100 WP_005091102.1.54172 WP_005091102.1.54308 WP_005091102.1.54405 WP_005091102.1.5447 WP_005091102.1.54520 WP_005091102.1.5484 WP_005091102.1.54871 WP_005091102.1.55017 WP_005091102.1.5505 WP_005091102.1.55348 WP_005091102.1.5542 WP_005091102.1.55518 WP_005091102.1.55666 WP_005091102.1.55667 WP_005091102.1.55928 WP_005091102.1.56034 WP_005091102.1.5624 WP_005091102.1.56308 WP_005091102.1.56401 WP_005091102.1.5643 WP_005091102.1.57154 WP_005091102.1.5733 WP_005091102.1.57775 WP_005091102.1.57848 WP_005091102.1.58203 WP_005091102.1.58611 WP_005091102.1.58688 WP_005091102.1.58864 WP_005091102.1.59000 WP_005091102.1.59021 WP_005091102.1.59400 WP_005091102.1.59436 WP_005091102.1.59758 WP_005091102.1.59909 WP_005091102.1.60173 WP_005091102.1.60262 WP_005091102.1.60475 WP_005091102.1.6062 WP_005091102.1.60653 WP_005091102.1.6067 WP_005091102.1.60728 WP_005091102.1.6098 WP_005091102.1.61033 WP_005091102.1.61066 WP_005091102.1.61196 WP_005091102.1.61240 WP_005091102.1.61262 WP_005091102.1.61461 WP_005091102.1.61467 WP_005091102.1.61583 WP_005091102.1.61680 WP_005091102.1.62332 WP_005091102.1.62399 WP_005091102.1.62515 WP_005091102.1.62893 WP_005091102.1.63648 WP_005091102.1.64004 WP_005091102.1.64052 WP_005091102.1.64466 WP_005091102.1.64503 WP_005091102.1.64600 WP_005091102.1.64606 WP_005091102.1.64633 WP_005091102.1.64808 WP_005091102.1.65081 WP_005091102.1.65109 WP_005091102.1.65257 WP_005091102.1.65330 WP_005091102.1.65473 WP_005091102.1.65873 WP_005091102.1.66267 WP_005091102.1.66585 WP_005091102.1.66877 WP_005091102.1.66992 WP_005091102.1.67011 WP_005091102.1.67079 WP_005091102.1.67159 WP_005091102.1.67248 WP_005091102.1.67364 WP_005091102.1.67484 WP_005091102.1.67812 WP_005091102.1.67960 WP_005091102.1.68026 WP_005091102.1.6805 WP_005091102.1.69070 WP_005091102.1.69272 WP_005091102.1.69391 WP_005091102.1.69406 WP_005091102.1.69660 WP_005091102.1.69886 WP_005091102.1.70008 WP_005091102.1.70284 WP_005091102.1.70612 WP_005091102.1.70638 WP_005091102.1.70769 WP_005091102.1.7080 WP_005091102.1.70902 WP_005091102.1.70946 WP_005091102.1.71238 WP_005091102.1.71647 WP_005091102.1.72094 WP_005091102.1.72134 WP_005091102.1.73176 WP_005091102.1.73422 WP_005091102.1.73497 WP_005091102.1.7355 WP_005091102.1.73624 WP_005091102.1.73698 WP_005091102.1.73798 WP_005091102.1.74092 WP_005091102.1.74143 WP_005091102.1.7439 WP_005091102.1.74543 WP_005091102.1.74546 WP_005091102.1.74599 WP_005091102.1.74816 WP_005091102.1.7486 WP_005091102.1.74893 WP_005091102.1.74986 WP_005091102.1.75079 WP_005091102.1.75097 WP_005091102.1.75372 WP_005091102.1.7551 WP_005091102.1.75655 WP_005091102.1.75730 WP_005091102.1.76326 WP_005091102.1.76392 WP_005091102.1.7644 WP_005091102.1.76494 WP_005091102.1.76812 WP_005091102.1.76896 WP_005091102.1.77009 WP_005091102.1.77139 WP_005091102.1.77169 WP_005091102.1.77633 WP_005091102.1.77728 WP_005091102.1.77856 WP_005091102.1.78005 WP_005091102.1.7805 WP_005091102.1.78072 WP_005091102.1.78329 WP_005091102.1.78374 WP_005091102.1.78378 WP_005091102.1.78857 WP_005091102.1.78940 WP_005091102.1.78997 WP_005091102.1.79063 WP_005091102.1.79220 WP_005091102.1.79352 WP_005091102.1.7943 WP_005091102.1.79432 WP_005091102.1.79533 WP_005091102.1.79538 WP_005091102.1.80064 WP_005091102.1.80108 WP_005091102.1.8027 WP_005091102.1.80276 WP_005091102.1.80291 WP_005091102.1.80836 WP_005091102.1.81397 WP_005091102.1.81691 WP_005091102.1.81901 WP_005091102.1.82056 WP_005091102.1.82102 WP_005091102.1.82508 WP_005091102.1.82817 WP_005091102.1.83600 WP_005091102.1.83753 WP_005091102.1.83823 WP_005091102.1.83869 WP_005091102.1.841 WP_005091102.1.84132 WP_005091102.1.84301 WP_005091102.1.84386 WP_005091102.1.84733 WP_005091102.1.84870 WP_005091102.1.85337 WP_005091102.1.85448 WP_005091102.1.85573 WP_005091102.1.85644 WP_005091102.1.85949 WP_005091102.1.86071 WP_005091102.1.8628 WP_005091102.1.86463 WP_005091102.1.86623 WP_005091102.1.86974 WP_005091102.1.87049 WP_005091102.1.87080 WP_005091102.1.87103 WP_005091102.1.872 WP_005091102.1.87330 WP_005091102.1.87356 WP_005091102.1.87408 WP_005091102.1.8743 WP_005091102.1.87506 WP_005091102.1.87765 WP_005091102.1.88300 WP_005091102.1.88334 WP_005091102.1.88416 WP_005091102.1.88581 WP_005091102.1.88831 WP_005091102.1.88945 WP_005091102.1.89112 WP_005091102.1.89167 WP_005091102.1.8939 WP_005091102.1.89501 WP_005091102.1.89758 WP_005091102.1.90006 WP_005091102.1.90082 WP_005091102.1.90336 WP_005091102.1.90611 WP_005091102.1.90629 WP_005091102.1.90736 WP_005091102.1.90825 WP_005091102.1.91083 WP_005091102.1.91531 WP_005091102.1.91669 WP_005091102.1.91708 WP_005091102.1.91883 WP_005091102.1.92440 WP_005091102.1.92841 WP_005091102.1.93089 WP_005091102.1.93391 WP_005091102.1.93481 WP_005091102.1.93553 WP_005091102.1.93655 WP_005091102.1.93852 WP_005091102.1.94049 WP_005091102.1.9417 WP_005091102.1.94186 WP_005091102.1.94295 WP_005091102.1.94829 WP_005091102.1.9486 WP_005091102.1.94870 WP_005091102.1.95131 WP_005091102.1.95314 WP_005091102.1.95397 WP_005091102.1.95511 WP_005091102.1.9588 WP_005091102.1.95900 WP_005091102.1.96191 WP_005091102.1.96366 WP_005091102.1.96402 WP_005091102.1.9655 WP_005091102.1.9656 WP_005091102.1.96736 WP_005091102.1.96816 WP_005091102.1.97483 WP_005091102.1.97542 WP_005091102.1.97694 WP_005091102.1.97904 WP_005091102.1.98079 WP_005091102.1.9810 WP_005091102.1.98169 WP_005091102.1.98405 WP_005091102.1.98426 WP_005091102.1.98444 WP_005091102.1.98613 WP_005091102.1.98867 WP_005091102.1.99526 WP_005091102.1.99877 WP_005091102.1.99942 YP_001700959.1.21298 gi|169627310|ref|YP_001700959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]