SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169627455|ref|YP_001701104.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169627455|ref|YP_001701104.1|
Domain Number 1 Region: 4-482
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.93e-195
Family Heme-dependent catalases 0.000000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169627455|ref|YP_001701104.1|
Sequence length 487
Comment Catalase [Mycobacterium abscessus]
Sequence
MSNRTTTNTGIAVESDDESLTAGTQGPVLLHDHYLIEKLAQFNRERVPERIVHAKGAGAY
GELVITADVSKYTKAKLFQPGAKTESLARFSTVAGEQGSPDSWRDPRGFAVKFYTEDGNY
DLVGNNTPVFFIRDAIKFPDFIRSQKRLPGSGLRDHNMQWDFWTLRPETAHQVTWLMGDR
GIPKTYRHMNGYGSHTYQWINAEGERFWVKYHFKTDQGHDFLTQQEADELAGSDADAHRR
DLWNAIEDGNFPSWTLHVQVMPVDEAAGYRFNPFDLTKVWSKKDYPLIEVGKWTLNRNPR
NYFVEIEQAAFEPSNIVPGIGFSPDKMLLGRVFAYADAHRYRIGTNYAQLPPNAPRAATV
NSYSKEGPMRYHFNDPEVPVYAPNSFGGPHADPEAAGDGGVWEFDGTAVRAGYIQHAEDG
DFVQAGTLVREVLDDEQRARLAGNIVGHVLDGVSEPVLSRVFEYWKNVDPELGKAVEEGV
RAGLDAK
Download sequence
Identical sequences A0A0U0YSS9 A0A1N1S4Y3 B1MFQ0 X8DX55
561007.MAB_0351 gi|169627455|ref|YP_001701104.1| WP_005083610.1.100187 WP_005083610.1.100273 WP_005083610.1.10036 WP_005083610.1.10062 WP_005083610.1.100637 WP_005083610.1.101308 WP_005083610.1.101669 WP_005083610.1.101761 WP_005083610.1.10195 WP_005083610.1.102079 WP_005083610.1.10242 WP_005083610.1.10267 WP_005083610.1.10318 WP_005083610.1.10427 WP_005083610.1.10446 WP_005083610.1.10637 WP_005083610.1.10759 WP_005083610.1.10847 WP_005083610.1.1088 WP_005083610.1.10897 WP_005083610.1.11054 WP_005083610.1.11198 WP_005083610.1.1121 WP_005083610.1.11630 WP_005083610.1.11739 WP_005083610.1.11832 WP_005083610.1.11968 WP_005083610.1.12455 WP_005083610.1.12515 WP_005083610.1.1265 WP_005083610.1.13300 WP_005083610.1.13688 WP_005083610.1.13767 WP_005083610.1.14278 WP_005083610.1.14836 WP_005083610.1.14912 WP_005083610.1.15388 WP_005083610.1.15400 WP_005083610.1.15662 WP_005083610.1.15721 WP_005083610.1.15804 WP_005083610.1.1637 WP_005083610.1.16615 WP_005083610.1.16629 WP_005083610.1.16644 WP_005083610.1.16865 WP_005083610.1.1694 WP_005083610.1.1695 WP_005083610.1.16984 WP_005083610.1.16991 WP_005083610.1.17166 WP_005083610.1.17175 WP_005083610.1.17305 WP_005083610.1.17335 WP_005083610.1.17404 WP_005083610.1.1747 WP_005083610.1.17740 WP_005083610.1.1791 WP_005083610.1.18049 WP_005083610.1.18198 WP_005083610.1.18480 WP_005083610.1.18536 WP_005083610.1.18593 WP_005083610.1.18608 WP_005083610.1.19046 WP_005083610.1.19110 WP_005083610.1.1941 WP_005083610.1.19507 WP_005083610.1.19886 WP_005083610.1.19896 WP_005083610.1.19927 WP_005083610.1.20064 WP_005083610.1.20384 WP_005083610.1.2059 WP_005083610.1.20670 WP_005083610.1.21293 WP_005083610.1.21438 WP_005083610.1.2145 WP_005083610.1.21539 WP_005083610.1.21557 WP_005083610.1.21654 WP_005083610.1.21736 WP_005083610.1.2184 WP_005083610.1.22070 WP_005083610.1.22085 WP_005083610.1.22456 WP_005083610.1.22634 WP_005083610.1.22913 WP_005083610.1.23249 WP_005083610.1.23367 WP_005083610.1.2379 WP_005083610.1.24030 WP_005083610.1.24459 WP_005083610.1.24518 WP_005083610.1.24922 WP_005083610.1.25031 WP_005083610.1.25376 WP_005083610.1.25544 WP_005083610.1.26011 WP_005083610.1.26114 WP_005083610.1.26173 WP_005083610.1.26382 WP_005083610.1.27110 WP_005083610.1.27240 WP_005083610.1.27378 WP_005083610.1.27406 WP_005083610.1.27499 WP_005083610.1.27648 WP_005083610.1.27942 WP_005083610.1.28129 WP_005083610.1.28150 WP_005083610.1.2834 WP_005083610.1.28403 WP_005083610.1.28598 WP_005083610.1.28820 WP_005083610.1.28966 WP_005083610.1.29254 WP_005083610.1.29482 WP_005083610.1.29488 WP_005083610.1.29621 WP_005083610.1.29801 WP_005083610.1.30117 WP_005083610.1.30285 WP_005083610.1.30334 WP_005083610.1.30434 WP_005083610.1.30557 WP_005083610.1.30559 WP_005083610.1.30632 WP_005083610.1.30651 WP_005083610.1.31072 WP_005083610.1.31284 WP_005083610.1.31318 WP_005083610.1.31331 WP_005083610.1.31561 WP_005083610.1.31731 WP_005083610.1.31981 WP_005083610.1.32467 WP_005083610.1.32999 WP_005083610.1.33117 WP_005083610.1.33207 WP_005083610.1.33462 WP_005083610.1.33858 WP_005083610.1.3453 WP_005083610.1.34687 WP_005083610.1.34802 WP_005083610.1.349 WP_005083610.1.34927 WP_005083610.1.34974 WP_005083610.1.34987 WP_005083610.1.35263 WP_005083610.1.35390 WP_005083610.1.35414 WP_005083610.1.35437 WP_005083610.1.35462 WP_005083610.1.35745 WP_005083610.1.36143 WP_005083610.1.36256 WP_005083610.1.36505 WP_005083610.1.36548 WP_005083610.1.36589 WP_005083610.1.36677 WP_005083610.1.36871 WP_005083610.1.37030 WP_005083610.1.37083 WP_005083610.1.3711 WP_005083610.1.37505 WP_005083610.1.37704 WP_005083610.1.37763 WP_005083610.1.37873 WP_005083610.1.37916 WP_005083610.1.37946 WP_005083610.1.37949 WP_005083610.1.38019 WP_005083610.1.38173 WP_005083610.1.38570 WP_005083610.1.38576 WP_005083610.1.38720 WP_005083610.1.38745 WP_005083610.1.38854 WP_005083610.1.39792 WP_005083610.1.39987 WP_005083610.1.40102 WP_005083610.1.40105 WP_005083610.1.40260 WP_005083610.1.4054 WP_005083610.1.40829 WP_005083610.1.4100 WP_005083610.1.41111 WP_005083610.1.41120 WP_005083610.1.41217 WP_005083610.1.4165 WP_005083610.1.4174 WP_005083610.1.41760 WP_005083610.1.41841 WP_005083610.1.41866 WP_005083610.1.42008 WP_005083610.1.42251 WP_005083610.1.42468 WP_005083610.1.42511 WP_005083610.1.42860 WP_005083610.1.42909 WP_005083610.1.43224 WP_005083610.1.43254 WP_005083610.1.43412 WP_005083610.1.43451 WP_005083610.1.43777 WP_005083610.1.43982 WP_005083610.1.44116 WP_005083610.1.44454 WP_005083610.1.44542 WP_005083610.1.44648 WP_005083610.1.44819 WP_005083610.1.45603 WP_005083610.1.46008 WP_005083610.1.4618 WP_005083610.1.46298 WP_005083610.1.46404 WP_005083610.1.47088 WP_005083610.1.47233 WP_005083610.1.4732 WP_005083610.1.47590 WP_005083610.1.47597 WP_005083610.1.48062 WP_005083610.1.48254 WP_005083610.1.48386 WP_005083610.1.4856 WP_005083610.1.4862 WP_005083610.1.49067 WP_005083610.1.49908 WP_005083610.1.50079 WP_005083610.1.50524 WP_005083610.1.50671 WP_005083610.1.50738 WP_005083610.1.50749 WP_005083610.1.5130 WP_005083610.1.51350 WP_005083610.1.51577 WP_005083610.1.51905 WP_005083610.1.52379 WP_005083610.1.52471 WP_005083610.1.52925 WP_005083610.1.53018 WP_005083610.1.53301 WP_005083610.1.5339 WP_005083610.1.53562 WP_005083610.1.53644 WP_005083610.1.53880 WP_005083610.1.53890 WP_005083610.1.54100 WP_005083610.1.54405 WP_005083610.1.54672 WP_005083610.1.5484 WP_005083610.1.5492 WP_005083610.1.5505 WP_005083610.1.5542 WP_005083610.1.55436 WP_005083610.1.55518 WP_005083610.1.55667 WP_005083610.1.55842 WP_005083610.1.56079 WP_005083610.1.56147 WP_005083610.1.5624 WP_005083610.1.56308 WP_005083610.1.5643 WP_005083610.1.56695 WP_005083610.1.56731 WP_005083610.1.57154 WP_005083610.1.57243 WP_005083610.1.5733 WP_005083610.1.57353 WP_005083610.1.57762 WP_005083610.1.57775 WP_005083610.1.57848 WP_005083610.1.58203 WP_005083610.1.58611 WP_005083610.1.58616 WP_005083610.1.58651 WP_005083610.1.58654 WP_005083610.1.58688 WP_005083610.1.58773 WP_005083610.1.58864 WP_005083610.1.59000 WP_005083610.1.59021 WP_005083610.1.59059 WP_005083610.1.59400 WP_005083610.1.59473 WP_005083610.1.59634 WP_005083610.1.59758 WP_005083610.1.59806 WP_005083610.1.59904 WP_005083610.1.59909 WP_005083610.1.59941 WP_005083610.1.60315 WP_005083610.1.60626 WP_005083610.1.6067 WP_005083610.1.60680 WP_005083610.1.60945 WP_005083610.1.60967 WP_005083610.1.61054 WP_005083610.1.61117 WP_005083610.1.61240 WP_005083610.1.61262 WP_005083610.1.61467 WP_005083610.1.61504 WP_005083610.1.61583 WP_005083610.1.61680 WP_005083610.1.6182 WP_005083610.1.61840 WP_005083610.1.61984 WP_005083610.1.62332 WP_005083610.1.62399 WP_005083610.1.63105 WP_005083610.1.63355 WP_005083610.1.63366 WP_005083610.1.63377 WP_005083610.1.63772 WP_005083610.1.64004 WP_005083610.1.64052 WP_005083610.1.64100 WP_005083610.1.64324 WP_005083610.1.64503 WP_005083610.1.64590 WP_005083610.1.64606 WP_005083610.1.64633 WP_005083610.1.64808 WP_005083610.1.65081 WP_005083610.1.65257 WP_005083610.1.65330 WP_005083610.1.65473 WP_005083610.1.65605 WP_005083610.1.65873 WP_005083610.1.66585 WP_005083610.1.6699 WP_005083610.1.67159 WP_005083610.1.67248 WP_005083610.1.67364 WP_005083610.1.67550 WP_005083610.1.67960 WP_005083610.1.68026 WP_005083610.1.6805 WP_005083610.1.68165 WP_005083610.1.68654 WP_005083610.1.68680 WP_005083610.1.69070 WP_005083610.1.69272 WP_005083610.1.69370 WP_005083610.1.69391 WP_005083610.1.69886 WP_005083610.1.69924 WP_005083610.1.70008 WP_005083610.1.70769 WP_005083610.1.71122 WP_005083610.1.71647 WP_005083610.1.71682 WP_005083610.1.72094 WP_005083610.1.72134 WP_005083610.1.72278 WP_005083610.1.73176 WP_005083610.1.73422 WP_005083610.1.73452 WP_005083610.1.73460 WP_005083610.1.7355 WP_005083610.1.73624 WP_005083610.1.73664 WP_005083610.1.73671 WP_005083610.1.73698 WP_005083610.1.73798 WP_005083610.1.74092 WP_005083610.1.74108 WP_005083610.1.74143 WP_005083610.1.74543 WP_005083610.1.74546 WP_005083610.1.74599 WP_005083610.1.7486 WP_005083610.1.74893 WP_005083610.1.74986 WP_005083610.1.75097 WP_005083610.1.75613 WP_005083610.1.75662 WP_005083610.1.75736 WP_005083610.1.76326 WP_005083610.1.7644 WP_005083610.1.77009 WP_005083610.1.77633 WP_005083610.1.77728 WP_005083610.1.7783 WP_005083610.1.77856 WP_005083610.1.78005 WP_005083610.1.78072 WP_005083610.1.78227 WP_005083610.1.78329 WP_005083610.1.78374 WP_005083610.1.78857 WP_005083610.1.79063 WP_005083610.1.79352 WP_005083610.1.7943 WP_005083610.1.79432 WP_005083610.1.79491 WP_005083610.1.79533 WP_005083610.1.79559 WP_005083610.1.80276 WP_005083610.1.80836 WP_005083610.1.81099 WP_005083610.1.8139 WP_005083610.1.81397 WP_005083610.1.81691 WP_005083610.1.81797 WP_005083610.1.82056 WP_005083610.1.82147 WP_005083610.1.82508 WP_005083610.1.82576 WP_005083610.1.82817 WP_005083610.1.83230 WP_005083610.1.8333 WP_005083610.1.83600 WP_005083610.1.83687 WP_005083610.1.83753 WP_005083610.1.83823 WP_005083610.1.83849 WP_005083610.1.83869 WP_005083610.1.84009 WP_005083610.1.84132 WP_005083610.1.84157 WP_005083610.1.84301 WP_005083610.1.84346 WP_005083610.1.84386 WP_005083610.1.84733 WP_005083610.1.84862 WP_005083610.1.84870 WP_005083610.1.85050 WP_005083610.1.85345 WP_005083610.1.85448 WP_005083610.1.86071 WP_005083610.1.86121 WP_005083610.1.8628 WP_005083610.1.86974 WP_005083610.1.87049 WP_005083610.1.87080 WP_005083610.1.87241 WP_005083610.1.87356 WP_005083610.1.87974 WP_005083610.1.88334 WP_005083610.1.88581 WP_005083610.1.88831 WP_005083610.1.88945 WP_005083610.1.89015 WP_005083610.1.89167 WP_005083610.1.90082 WP_005083610.1.90336 WP_005083610.1.90461 WP_005083610.1.90611 WP_005083610.1.90825 WP_005083610.1.91302 WP_005083610.1.91531 WP_005083610.1.91819 WP_005083610.1.92267 WP_005083610.1.92312 WP_005083610.1.92841 WP_005083610.1.93249 WP_005083610.1.93391 WP_005083610.1.93481 WP_005083610.1.93553 WP_005083610.1.93655 WP_005083610.1.93818 WP_005083610.1.94049 WP_005083610.1.94186 WP_005083610.1.94313 WP_005083610.1.94350 WP_005083610.1.94829 WP_005083610.1.9486 WP_005083610.1.95283 WP_005083610.1.95286 WP_005083610.1.95314 WP_005083610.1.95397 WP_005083610.1.95511 WP_005083610.1.9588 WP_005083610.1.95900 WP_005083610.1.95995 WP_005083610.1.96191 WP_005083610.1.96366 WP_005083610.1.9655 WP_005083610.1.96720 WP_005083610.1.96736 WP_005083610.1.97083 WP_005083610.1.9728 WP_005083610.1.97433 WP_005083610.1.97694 WP_005083610.1.97904 WP_005083610.1.9810 WP_005083610.1.98169 WP_005083610.1.98405 WP_005083610.1.98437 WP_005083610.1.98444 WP_005083610.1.98613 WP_005083610.1.99275 WP_005083610.1.99526 WP_005083610.1.99877 WP_005083610.1.99942 YP_001701104.1.21298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]