SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169628543|ref|YP_001702192.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169628543|ref|YP_001702192.1|
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.96e-78
Family ATP synthase (F1-ATPase), gamma subunit 0.0000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169628543|ref|YP_001702192.1|
Sequence length 308
Comment ATP synthase gamma subunit AtpG [Mycobacterium abscessus]
Sequence
MGAQIRELRRRIKSAGAIKKITKAQELIATSRIAKAQARVVAARPYATEITNVLTALADD
AALDHPLLVERPEPKRAGVLIVSSDRGLCGGYNANVLRVAEELYALLREQGKTPVVYVVG
RKALNYYSFRNRKVTEAWTGFSERPEYASAQKIADTLVEAFLAGADDEGDDPGLDGILGV
DELHIVYTEFKSMLTQAAVAKRIAPMEVEYVGEAAGPTTQYSFEPDATTLFGALLPRYLA
TRVYAALLEAAASESASRRRAMKAATDNADELIKGLTLEANGARQAQITQEISEIVGGVN
ALADAAGH
Download sequence
Identical sequences A0A0U0Y152 A0A1M8RXU0 A0A1M9VCR8 B1MLW1 X8EB29
WP_005074370.1.100187 WP_005074370.1.100247 WP_005074370.1.100248 WP_005074370.1.100273 WP_005074370.1.10036 WP_005074370.1.100423 WP_005074370.1.10062 WP_005074370.1.100637 WP_005074370.1.100838 WP_005074370.1.101070 WP_005074370.1.10120 WP_005074370.1.101308 WP_005074370.1.101341 WP_005074370.1.101669 WP_005074370.1.101761 WP_005074370.1.101774 WP_005074370.1.10195 WP_005074370.1.102079 WP_005074370.1.102118 WP_005074370.1.10242 WP_005074370.1.10267 WP_005074370.1.10280 WP_005074370.1.10318 WP_005074370.1.10427 WP_005074370.1.10446 WP_005074370.1.1056 WP_005074370.1.10637 WP_005074370.1.10759 WP_005074370.1.10847 WP_005074370.1.1088 WP_005074370.1.10897 WP_005074370.1.11054 WP_005074370.1.11198 WP_005074370.1.1121 WP_005074370.1.11401 WP_005074370.1.11630 WP_005074370.1.1170 WP_005074370.1.11739 WP_005074370.1.11832 WP_005074370.1.11946 WP_005074370.1.11968 WP_005074370.1.12402 WP_005074370.1.12455 WP_005074370.1.12509 WP_005074370.1.12515 WP_005074370.1.12577 WP_005074370.1.1265 WP_005074370.1.12716 WP_005074370.1.12894 WP_005074370.1.1296 WP_005074370.1.13146 WP_005074370.1.13300 WP_005074370.1.13688 WP_005074370.1.13767 WP_005074370.1.14019 WP_005074370.1.14052 WP_005074370.1.14278 WP_005074370.1.14308 WP_005074370.1.1460 WP_005074370.1.14685 WP_005074370.1.14836 WP_005074370.1.14912 WP_005074370.1.14940 WP_005074370.1.14988 WP_005074370.1.15051 WP_005074370.1.15348 WP_005074370.1.15388 WP_005074370.1.15400 WP_005074370.1.15662 WP_005074370.1.15721 WP_005074370.1.15804 WP_005074370.1.16211 WP_005074370.1.1637 WP_005074370.1.16496 WP_005074370.1.16615 WP_005074370.1.16629 WP_005074370.1.16644 WP_005074370.1.16789 WP_005074370.1.16865 WP_005074370.1.16906 WP_005074370.1.1694 WP_005074370.1.1695 WP_005074370.1.16984 WP_005074370.1.16989 WP_005074370.1.1706 WP_005074370.1.17166 WP_005074370.1.17175 WP_005074370.1.17305 WP_005074370.1.17335 WP_005074370.1.17404 WP_005074370.1.1747 WP_005074370.1.17674 WP_005074370.1.17740 WP_005074370.1.17877 WP_005074370.1.1791 WP_005074370.1.18002 WP_005074370.1.1804 WP_005074370.1.18044 WP_005074370.1.18049 WP_005074370.1.18198 WP_005074370.1.18350 WP_005074370.1.18359 WP_005074370.1.18480 WP_005074370.1.18536 WP_005074370.1.18593 WP_005074370.1.18596 WP_005074370.1.18608 WP_005074370.1.18683 WP_005074370.1.18839 WP_005074370.1.19046 WP_005074370.1.19110 WP_005074370.1.19331 WP_005074370.1.1941 WP_005074370.1.19507 WP_005074370.1.19592 WP_005074370.1.19628 WP_005074370.1.19797 WP_005074370.1.19886 WP_005074370.1.19896 WP_005074370.1.20004 WP_005074370.1.20225 WP_005074370.1.20384 WP_005074370.1.20428 WP_005074370.1.20581 WP_005074370.1.2059 WP_005074370.1.20670 WP_005074370.1.21014 WP_005074370.1.21141 WP_005074370.1.21290 WP_005074370.1.21293 WP_005074370.1.21385 WP_005074370.1.21438 WP_005074370.1.2145 WP_005074370.1.21539 WP_005074370.1.21557 WP_005074370.1.21654 WP_005074370.1.21707 WP_005074370.1.21736 WP_005074370.1.2184 WP_005074370.1.22070 WP_005074370.1.22085 WP_005074370.1.22183 WP_005074370.1.2226 WP_005074370.1.22456 WP_005074370.1.22634 WP_005074370.1.22913 WP_005074370.1.23203 WP_005074370.1.23249 WP_005074370.1.23367 WP_005074370.1.23524 WP_005074370.1.23655 WP_005074370.1.23773 WP_005074370.1.2378 WP_005074370.1.2379 WP_005074370.1.2393 WP_005074370.1.24030 WP_005074370.1.24032 WP_005074370.1.24265 WP_005074370.1.24459 WP_005074370.1.24518 WP_005074370.1.24751 WP_005074370.1.24828 WP_005074370.1.2492 WP_005074370.1.24922 WP_005074370.1.25031 WP_005074370.1.25108 WP_005074370.1.25282 WP_005074370.1.25376 WP_005074370.1.25544 WP_005074370.1.25601 WP_005074370.1.2577 WP_005074370.1.25796 WP_005074370.1.25884 WP_005074370.1.25889 WP_005074370.1.25898 WP_005074370.1.26011 WP_005074370.1.26114 WP_005074370.1.26173 WP_005074370.1.26382 WP_005074370.1.26417 WP_005074370.1.26462 WP_005074370.1.27025 WP_005074370.1.27110 WP_005074370.1.27232 WP_005074370.1.27240 WP_005074370.1.27326 WP_005074370.1.27378 WP_005074370.1.27406 WP_005074370.1.27499 WP_005074370.1.27586 WP_005074370.1.27625 WP_005074370.1.27648 WP_005074370.1.27942 WP_005074370.1.27979 WP_005074370.1.28129 WP_005074370.1.28150 WP_005074370.1.28243 WP_005074370.1.28280 WP_005074370.1.28300 WP_005074370.1.2834 WP_005074370.1.28344 WP_005074370.1.28403 WP_005074370.1.28438 WP_005074370.1.2858 WP_005074370.1.28598 WP_005074370.1.28820 WP_005074370.1.28966 WP_005074370.1.29254 WP_005074370.1.29353 WP_005074370.1.29458 WP_005074370.1.29482 WP_005074370.1.29488 WP_005074370.1.29621 WP_005074370.1.29801 WP_005074370.1.30117 WP_005074370.1.30285 WP_005074370.1.30334 WP_005074370.1.30434 WP_005074370.1.30557 WP_005074370.1.30559 WP_005074370.1.30632 WP_005074370.1.30651 WP_005074370.1.30751 WP_005074370.1.30938 WP_005074370.1.31072 WP_005074370.1.31244 WP_005074370.1.31284 WP_005074370.1.31318 WP_005074370.1.31331 WP_005074370.1.31448 WP_005074370.1.31561 WP_005074370.1.31731 WP_005074370.1.31788 WP_005074370.1.31981 WP_005074370.1.32105 WP_005074370.1.32467 WP_005074370.1.32530 WP_005074370.1.32613 WP_005074370.1.32993 WP_005074370.1.32999 WP_005074370.1.33 WP_005074370.1.33117 WP_005074370.1.33207 WP_005074370.1.33439 WP_005074370.1.33462 WP_005074370.1.33577 WP_005074370.1.33770 WP_005074370.1.33858 WP_005074370.1.33863 WP_005074370.1.33998 WP_005074370.1.34101 WP_005074370.1.34268 WP_005074370.1.3453 WP_005074370.1.34687 WP_005074370.1.34752 WP_005074370.1.34770 WP_005074370.1.34802 WP_005074370.1.349 WP_005074370.1.34927 WP_005074370.1.34974 WP_005074370.1.34987 WP_005074370.1.34988 WP_005074370.1.35004 WP_005074370.1.35191 WP_005074370.1.35263 WP_005074370.1.35375 WP_005074370.1.35390 WP_005074370.1.35414 WP_005074370.1.35437 WP_005074370.1.35462 WP_005074370.1.35607 WP_005074370.1.35622 WP_005074370.1.35745 WP_005074370.1.35846 WP_005074370.1.35941 WP_005074370.1.36056 WP_005074370.1.36143 WP_005074370.1.36256 WP_005074370.1.36482 WP_005074370.1.36505 WP_005074370.1.36539 WP_005074370.1.36548 WP_005074370.1.36589 WP_005074370.1.36677 WP_005074370.1.36769 WP_005074370.1.36871 WP_005074370.1.36964 WP_005074370.1.37030 WP_005074370.1.3711 WP_005074370.1.37448 WP_005074370.1.37505 WP_005074370.1.37704 WP_005074370.1.37763 WP_005074370.1.37873 WP_005074370.1.37916 WP_005074370.1.37946 WP_005074370.1.37949 WP_005074370.1.38005 WP_005074370.1.38019 WP_005074370.1.38083 WP_005074370.1.38166 WP_005074370.1.38173 WP_005074370.1.38250 WP_005074370.1.38360 WP_005074370.1.38552 WP_005074370.1.38570 WP_005074370.1.38576 WP_005074370.1.38720 WP_005074370.1.38745 WP_005074370.1.38803 WP_005074370.1.38846 WP_005074370.1.38854 WP_005074370.1.39231 WP_005074370.1.39707 WP_005074370.1.39790 WP_005074370.1.39792 WP_005074370.1.39987 WP_005074370.1.40102 WP_005074370.1.40105 WP_005074370.1.40116 WP_005074370.1.40144 WP_005074370.1.40260 WP_005074370.1.4054 WP_005074370.1.40829 WP_005074370.1.40929 WP_005074370.1.4100 WP_005074370.1.4104 WP_005074370.1.41111 WP_005074370.1.41120 WP_005074370.1.41217 WP_005074370.1.4150 WP_005074370.1.41576 WP_005074370.1.41678 WP_005074370.1.4174 WP_005074370.1.41760 WP_005074370.1.41841 WP_005074370.1.41843 WP_005074370.1.41866 WP_005074370.1.42008 WP_005074370.1.42097 WP_005074370.1.42192 WP_005074370.1.42251 WP_005074370.1.42274 WP_005074370.1.42296 WP_005074370.1.42428 WP_005074370.1.42468 WP_005074370.1.42751 WP_005074370.1.42753 WP_005074370.1.42833 WP_005074370.1.42860 WP_005074370.1.42909 WP_005074370.1.43071 WP_005074370.1.43224 WP_005074370.1.43254 WP_005074370.1.43402 WP_005074370.1.43412 WP_005074370.1.43421 WP_005074370.1.43451 WP_005074370.1.43626 WP_005074370.1.4368 WP_005074370.1.43718 WP_005074370.1.43777 WP_005074370.1.43843 WP_005074370.1.43940 WP_005074370.1.43971 WP_005074370.1.43982 WP_005074370.1.44116 WP_005074370.1.4424 WP_005074370.1.44333 WP_005074370.1.44363 WP_005074370.1.44454 WP_005074370.1.44542 WP_005074370.1.44560 WP_005074370.1.44648 WP_005074370.1.44819 WP_005074370.1.45069 WP_005074370.1.45292 WP_005074370.1.45315 WP_005074370.1.45603 WP_005074370.1.46008 WP_005074370.1.4611 WP_005074370.1.4618 WP_005074370.1.46214 WP_005074370.1.46298 WP_005074370.1.46371 WP_005074370.1.46404 WP_005074370.1.46638 WP_005074370.1.47003 WP_005074370.1.47088 WP_005074370.1.47134 WP_005074370.1.47233 WP_005074370.1.4732 WP_005074370.1.47359 WP_005074370.1.47580 WP_005074370.1.47590 WP_005074370.1.47597 WP_005074370.1.47870 WP_005074370.1.48062 WP_005074370.1.48174 WP_005074370.1.48254 WP_005074370.1.48386 WP_005074370.1.48516 WP_005074370.1.48530 WP_005074370.1.4856 WP_005074370.1.4862 WP_005074370.1.48816 WP_005074370.1.48940 WP_005074370.1.49067 WP_005074370.1.49125 WP_005074370.1.49142 WP_005074370.1.49180 WP_005074370.1.49468 WP_005074370.1.49908 WP_005074370.1.50020 WP_005074370.1.50040 WP_005074370.1.50079 WP_005074370.1.50140 WP_005074370.1.50203 WP_005074370.1.50524 WP_005074370.1.50671 WP_005074370.1.50738 WP_005074370.1.50749 WP_005074370.1.50946 WP_005074370.1.50973 WP_005074370.1.51108 WP_005074370.1.51292 WP_005074370.1.5130 WP_005074370.1.51350 WP_005074370.1.51442 WP_005074370.1.51577 WP_005074370.1.51905 WP_005074370.1.52022 WP_005074370.1.52084 WP_005074370.1.52141 WP_005074370.1.52265 WP_005074370.1.52300 WP_005074370.1.52379 WP_005074370.1.52471 WP_005074370.1.52661 WP_005074370.1.527 WP_005074370.1.52718 WP_005074370.1.52925 WP_005074370.1.53018 WP_005074370.1.53026 WP_005074370.1.53029 WP_005074370.1.53301 WP_005074370.1.5339 WP_005074370.1.53562 WP_005074370.1.53591 WP_005074370.1.53644 WP_005074370.1.53880 WP_005074370.1.53890 WP_005074370.1.54100 WP_005074370.1.54172 WP_005074370.1.54308 WP_005074370.1.54405 WP_005074370.1.54443 WP_005074370.1.5447 WP_005074370.1.54520 WP_005074370.1.54672 WP_005074370.1.54726 WP_005074370.1.5484 WP_005074370.1.54871 WP_005074370.1.55017 WP_005074370.1.5505 WP_005074370.1.55348 WP_005074370.1.5542 WP_005074370.1.55436 WP_005074370.1.55518 WP_005074370.1.55666 WP_005074370.1.55667 WP_005074370.1.55778 WP_005074370.1.55842 WP_005074370.1.55928 WP_005074370.1.56034 WP_005074370.1.56079 WP_005074370.1.5624 WP_005074370.1.56308 WP_005074370.1.56401 WP_005074370.1.5643 WP_005074370.1.56594 WP_005074370.1.56731 WP_005074370.1.57154 WP_005074370.1.5721 WP_005074370.1.57229 WP_005074370.1.57243 WP_005074370.1.5728 WP_005074370.1.5733 WP_005074370.1.57353 WP_005074370.1.57762 WP_005074370.1.57775 WP_005074370.1.57848 WP_005074370.1.58203 WP_005074370.1.58611 WP_005074370.1.58616 WP_005074370.1.58651 WP_005074370.1.58654 WP_005074370.1.58688 WP_005074370.1.58773 WP_005074370.1.58826 WP_005074370.1.5884 WP_005074370.1.58864 WP_005074370.1.59000 WP_005074370.1.59021 WP_005074370.1.59059 WP_005074370.1.59400 WP_005074370.1.59436 WP_005074370.1.59473 WP_005074370.1.59634 WP_005074370.1.59758 WP_005074370.1.59806 WP_005074370.1.59904 WP_005074370.1.59909 WP_005074370.1.59941 WP_005074370.1.59973 WP_005074370.1.60046 WP_005074370.1.60173 WP_005074370.1.60262 WP_005074370.1.60315 WP_005074370.1.60475 WP_005074370.1.60522 WP_005074370.1.6062 WP_005074370.1.60626 WP_005074370.1.60653 WP_005074370.1.6067 WP_005074370.1.60680 WP_005074370.1.60728 WP_005074370.1.60945 WP_005074370.1.60967 WP_005074370.1.6098 WP_005074370.1.61033 WP_005074370.1.61054 WP_005074370.1.61066 WP_005074370.1.61117 WP_005074370.1.61196 WP_005074370.1.61240 WP_005074370.1.61262 WP_005074370.1.61461 WP_005074370.1.61467 WP_005074370.1.61479 WP_005074370.1.61504 WP_005074370.1.61583 WP_005074370.1.61678 WP_005074370.1.61680 WP_005074370.1.61805 WP_005074370.1.6182 WP_005074370.1.61840 WP_005074370.1.61984 WP_005074370.1.62009 WP_005074370.1.62297 WP_005074370.1.62332 WP_005074370.1.62399 WP_005074370.1.62515 WP_005074370.1.62893 WP_005074370.1.63105 WP_005074370.1.63355 WP_005074370.1.63366 WP_005074370.1.63377 WP_005074370.1.63457 WP_005074370.1.63648 WP_005074370.1.63772 WP_005074370.1.64004 WP_005074370.1.64052 WP_005074370.1.64100 WP_005074370.1.64324 WP_005074370.1.64466 WP_005074370.1.64503 WP_005074370.1.64590 WP_005074370.1.64600 WP_005074370.1.64606 WP_005074370.1.64633 WP_005074370.1.6466 WP_005074370.1.64808 WP_005074370.1.65048 WP_005074370.1.65081 WP_005074370.1.65109 WP_005074370.1.65257 WP_005074370.1.65330 WP_005074370.1.65473 WP_005074370.1.65605 WP_005074370.1.65873 WP_005074370.1.65888 WP_005074370.1.66192 WP_005074370.1.66267 WP_005074370.1.66585 WP_005074370.1.6699 WP_005074370.1.66992 WP_005074370.1.67011 WP_005074370.1.67079 WP_005074370.1.67130 WP_005074370.1.67159 WP_005074370.1.67248 WP_005074370.1.67326 WP_005074370.1.67364 WP_005074370.1.67484 WP_005074370.1.67550 WP_005074370.1.67812 WP_005074370.1.67960 WP_005074370.1.68026 WP_005074370.1.6805 WP_005074370.1.68165 WP_005074370.1.68423 WP_005074370.1.68500 WP_005074370.1.68654 WP_005074370.1.68680 WP_005074370.1.68685 WP_005074370.1.69070 WP_005074370.1.69272 WP_005074370.1.69370 WP_005074370.1.69386 WP_005074370.1.69391 WP_005074370.1.69406 WP_005074370.1.69660 WP_005074370.1.69886 WP_005074370.1.69924 WP_005074370.1.70008 WP_005074370.1.70284 WP_005074370.1.70416 WP_005074370.1.70569 WP_005074370.1.70612 WP_005074370.1.70638 WP_005074370.1.70769 WP_005074370.1.7080 WP_005074370.1.70902 WP_005074370.1.70946 WP_005074370.1.71122 WP_005074370.1.71230 WP_005074370.1.71238 WP_005074370.1.71647 WP_005074370.1.71682 WP_005074370.1.71722 WP_005074370.1.71779 WP_005074370.1.72056 WP_005074370.1.72094 WP_005074370.1.72134 WP_005074370.1.72278 WP_005074370.1.72613 WP_005074370.1.72668 WP_005074370.1.7306 WP_005074370.1.73176 WP_005074370.1.73415 WP_005074370.1.73422 WP_005074370.1.73452 WP_005074370.1.73460 WP_005074370.1.73497 WP_005074370.1.7355 WP_005074370.1.73624 WP_005074370.1.73664 WP_005074370.1.73671 WP_005074370.1.73698 WP_005074370.1.73746 WP_005074370.1.73798 WP_005074370.1.73861 WP_005074370.1.74092 WP_005074370.1.74108 WP_005074370.1.74143 WP_005074370.1.7439 WP_005074370.1.7441 WP_005074370.1.74543 WP_005074370.1.74599 WP_005074370.1.74668 WP_005074370.1.74815 WP_005074370.1.74816 WP_005074370.1.7486 WP_005074370.1.74893 WP_005074370.1.74986 WP_005074370.1.75079 WP_005074370.1.75097 WP_005074370.1.75352 WP_005074370.1.75372 WP_005074370.1.7551 WP_005074370.1.75613 WP_005074370.1.75655 WP_005074370.1.75662 WP_005074370.1.75730 WP_005074370.1.75736 WP_005074370.1.76326 WP_005074370.1.76392 WP_005074370.1.7644 WP_005074370.1.76494 WP_005074370.1.76812 WP_005074370.1.76896 WP_005074370.1.77009 WP_005074370.1.77139 WP_005074370.1.77169 WP_005074370.1.77171 WP_005074370.1.77633 WP_005074370.1.77728 WP_005074370.1.7783 WP_005074370.1.77856 WP_005074370.1.78005 WP_005074370.1.7805 WP_005074370.1.78072 WP_005074370.1.78227 WP_005074370.1.78329 WP_005074370.1.78374 WP_005074370.1.78378 WP_005074370.1.78476 WP_005074370.1.78857 WP_005074370.1.78940 WP_005074370.1.78997 WP_005074370.1.79063 WP_005074370.1.79220 WP_005074370.1.79352 WP_005074370.1.7943 WP_005074370.1.79432 WP_005074370.1.79491 WP_005074370.1.79533 WP_005074370.1.79538 WP_005074370.1.79559 WP_005074370.1.80064 WP_005074370.1.80108 WP_005074370.1.8027 WP_005074370.1.80291 WP_005074370.1.80489 WP_005074370.1.8082 WP_005074370.1.80836 WP_005074370.1.80928 WP_005074370.1.81023 WP_005074370.1.81099 WP_005074370.1.8139 WP_005074370.1.81394 WP_005074370.1.81397 WP_005074370.1.81691 WP_005074370.1.81783 WP_005074370.1.81797 WP_005074370.1.81901 WP_005074370.1.82056 WP_005074370.1.82102 WP_005074370.1.82147 WP_005074370.1.82196 WP_005074370.1.82508 WP_005074370.1.82576 WP_005074370.1.82817 WP_005074370.1.8297 WP_005074370.1.83230 WP_005074370.1.83269 WP_005074370.1.8333 WP_005074370.1.83344 WP_005074370.1.83600 WP_005074370.1.83687 WP_005074370.1.83717 WP_005074370.1.83753 WP_005074370.1.83823 WP_005074370.1.83849 WP_005074370.1.83869 WP_005074370.1.84009 WP_005074370.1.8402 WP_005074370.1.841 WP_005074370.1.84132 WP_005074370.1.84346 WP_005074370.1.84386 WP_005074370.1.84733 WP_005074370.1.84862 WP_005074370.1.84870 WP_005074370.1.84882 WP_005074370.1.84928 WP_005074370.1.85050 WP_005074370.1.85337 WP_005074370.1.85345 WP_005074370.1.85448 WP_005074370.1.85573 WP_005074370.1.85644 WP_005074370.1.85949 WP_005074370.1.86064 WP_005074370.1.86071 WP_005074370.1.86121 WP_005074370.1.8628 WP_005074370.1.86463 WP_005074370.1.8659 WP_005074370.1.86623 WP_005074370.1.86862 WP_005074370.1.86917 WP_005074370.1.86974 WP_005074370.1.87049 WP_005074370.1.87080 WP_005074370.1.87103 WP_005074370.1.872 WP_005074370.1.87241 WP_005074370.1.87330 WP_005074370.1.87356 WP_005074370.1.87408 WP_005074370.1.8743 WP_005074370.1.87506 WP_005074370.1.87539 WP_005074370.1.87632 WP_005074370.1.87765 WP_005074370.1.87974 WP_005074370.1.88045 WP_005074370.1.88287 WP_005074370.1.88300 WP_005074370.1.88334 WP_005074370.1.88416 WP_005074370.1.88581 WP_005074370.1.88831 WP_005074370.1.88865 WP_005074370.1.88945 WP_005074370.1.89015 WP_005074370.1.89112 WP_005074370.1.89167 WP_005074370.1.8939 WP_005074370.1.89501 WP_005074370.1.89619 WP_005074370.1.89758 WP_005074370.1.90006 WP_005074370.1.90082 WP_005074370.1.90089 WP_005074370.1.90094 WP_005074370.1.90336 WP_005074370.1.90461 WP_005074370.1.90611 WP_005074370.1.90629 WP_005074370.1.90736 WP_005074370.1.90825 WP_005074370.1.91083 WP_005074370.1.91302 WP_005074370.1.91531 WP_005074370.1.91669 WP_005074370.1.91708 WP_005074370.1.91774 WP_005074370.1.9178 WP_005074370.1.91819 WP_005074370.1.91883 WP_005074370.1.92267 WP_005074370.1.92312 WP_005074370.1.92440 WP_005074370.1.92521 WP_005074370.1.92841 WP_005074370.1.93024 WP_005074370.1.93089 WP_005074370.1.93391 WP_005074370.1.93481 WP_005074370.1.93553 WP_005074370.1.93655 WP_005074370.1.93818 WP_005074370.1.93852 WP_005074370.1.93931 WP_005074370.1.94049 WP_005074370.1.94161 WP_005074370.1.9417 WP_005074370.1.94186 WP_005074370.1.94295 WP_005074370.1.94313 WP_005074370.1.94350 WP_005074370.1.94517 WP_005074370.1.94574 WP_005074370.1.9466 WP_005074370.1.94829 WP_005074370.1.9486 WP_005074370.1.94870 WP_005074370.1.95131 WP_005074370.1.95283 WP_005074370.1.95314 WP_005074370.1.95352 WP_005074370.1.95397 WP_005074370.1.95511 WP_005074370.1.9588 WP_005074370.1.95900 WP_005074370.1.95995 WP_005074370.1.96154 WP_005074370.1.96191 WP_005074370.1.9634 WP_005074370.1.96366 WP_005074370.1.96402 WP_005074370.1.96431 WP_005074370.1.96442 WP_005074370.1.9655 WP_005074370.1.9656 WP_005074370.1.96720 WP_005074370.1.96736 WP_005074370.1.96752 WP_005074370.1.96816 WP_005074370.1.97083 WP_005074370.1.9728 WP_005074370.1.97420 WP_005074370.1.97483 WP_005074370.1.97542 WP_005074370.1.97694 WP_005074370.1.97884 WP_005074370.1.97904 WP_005074370.1.98079 WP_005074370.1.9810 WP_005074370.1.98169 WP_005074370.1.98298 WP_005074370.1.98405 WP_005074370.1.98426 WP_005074370.1.98437 WP_005074370.1.98444 WP_005074370.1.98487 WP_005074370.1.98613 WP_005074370.1.98867 WP_005074370.1.99095 WP_005074370.1.99273 WP_005074370.1.99275 WP_005074370.1.99526 WP_005074370.1.99877 WP_005074370.1.99923 WP_005074370.1.99942 YP_001702192.1.21298 gi|169628543|ref|YP_001702192.1| 561007.MAB_1452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]