SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169628930|ref|YP_001702579.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169628930|ref|YP_001702579.1|
Domain Number 1 Region: 38-330
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.7e-60
Family Heme-dependent catalases 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169628930|ref|YP_001702579.1|
Sequence length 344
Comment Probable catalase [Mycobacterium abscessus]
Sequence
MVAHKLDRRMFVGLVAAGAVTVTGLGGFLALEGRAGSRLTGRSFIDLFEATGGRFVGYRR
NHAKALAVSGRFESNGAGAEISSASVFTAGVYPVSGRFSVGGQNPHQPDTGSGQALALEF
SLPGGEQWRTAMAAAPVFMAPTPEMFFGLLSARLSGDKDRVAAFMRDNPPAAAAQKLIEA
GPKASSFAAASYSSLNTFIFVTKNGVRTPVRWRVVPDGNPTGTAAKDGPNWMFEALAQRV
RFGELRYRLLLQIGVPGQDPTNDPTLPWPPDRRQIDAGTLVLGHAIPREQEHIRDTNFDP
TVLPTGIELSDDPILAARAAIYAESFRRRARETPAPVEQFGQDM
Download sequence
Identical sequences A0A142SBL5 A0A1U5DW51 B1MNM4 X8ETW3
gi|169628930|ref|YP_001702579.1| WP_005067306.1.100187 WP_005067306.1.100209 WP_005067306.1.100230 WP_005067306.1.100247 WP_005067306.1.100248 WP_005067306.1.100273 WP_005067306.1.10036 WP_005067306.1.100423 WP_005067306.1.10062 WP_005067306.1.100637 WP_005067306.1.100838 WP_005067306.1.10120 WP_005067306.1.101308 WP_005067306.1.101341 WP_005067306.1.101669 WP_005067306.1.101761 WP_005067306.1.101774 WP_005067306.1.102079 WP_005067306.1.10242 WP_005067306.1.10267 WP_005067306.1.10318 WP_005067306.1.10427 WP_005067306.1.10446 WP_005067306.1.10637 WP_005067306.1.10759 WP_005067306.1.10847 WP_005067306.1.1088 WP_005067306.1.10897 WP_005067306.1.11054 WP_005067306.1.11198 WP_005067306.1.1121 WP_005067306.1.11401 WP_005067306.1.11508 WP_005067306.1.11630 WP_005067306.1.1170 WP_005067306.1.11739 WP_005067306.1.11832 WP_005067306.1.11946 WP_005067306.1.11968 WP_005067306.1.12203 WP_005067306.1.12298 WP_005067306.1.12402 WP_005067306.1.12455 WP_005067306.1.12577 WP_005067306.1.12593 WP_005067306.1.1265 WP_005067306.1.12695 WP_005067306.1.12716 WP_005067306.1.12894 WP_005067306.1.13300 WP_005067306.1.13688 WP_005067306.1.13767 WP_005067306.1.14019 WP_005067306.1.14052 WP_005067306.1.14278 WP_005067306.1.14308 WP_005067306.1.1460 WP_005067306.1.14685 WP_005067306.1.14836 WP_005067306.1.14912 WP_005067306.1.14940 WP_005067306.1.15388 WP_005067306.1.15400 WP_005067306.1.15662 WP_005067306.1.15721 WP_005067306.1.16211 WP_005067306.1.1637 WP_005067306.1.16469 WP_005067306.1.16615 WP_005067306.1.16629 WP_005067306.1.16644 WP_005067306.1.16789 WP_005067306.1.16865 WP_005067306.1.16906 WP_005067306.1.1694 WP_005067306.1.16984 WP_005067306.1.16989 WP_005067306.1.1706 WP_005067306.1.17166 WP_005067306.1.17175 WP_005067306.1.17305 WP_005067306.1.17335 WP_005067306.1.17404 WP_005067306.1.1747 WP_005067306.1.17674 WP_005067306.1.1791 WP_005067306.1.1804 WP_005067306.1.18044 WP_005067306.1.18198 WP_005067306.1.18350 WP_005067306.1.18359 WP_005067306.1.18480 WP_005067306.1.18536 WP_005067306.1.18593 WP_005067306.1.18596 WP_005067306.1.18608 WP_005067306.1.18683 WP_005067306.1.18753 WP_005067306.1.18782 WP_005067306.1.19046 WP_005067306.1.19110 WP_005067306.1.19331 WP_005067306.1.1941 WP_005067306.1.19507 WP_005067306.1.19592 WP_005067306.1.19886 WP_005067306.1.19896 WP_005067306.1.19927 WP_005067306.1.20064 WP_005067306.1.20225 WP_005067306.1.20384 WP_005067306.1.20410 WP_005067306.1.20428 WP_005067306.1.2059 WP_005067306.1.20670 WP_005067306.1.21014 WP_005067306.1.21141 WP_005067306.1.21239 WP_005067306.1.21287 WP_005067306.1.21293 WP_005067306.1.21315 WP_005067306.1.21385 WP_005067306.1.21438 WP_005067306.1.2145 WP_005067306.1.21539 WP_005067306.1.21557 WP_005067306.1.21654 WP_005067306.1.21736 WP_005067306.1.2184 WP_005067306.1.22070 WP_005067306.1.22085 WP_005067306.1.22183 WP_005067306.1.2226 WP_005067306.1.22634 WP_005067306.1.23203 WP_005067306.1.23249 WP_005067306.1.23367 WP_005067306.1.23655 WP_005067306.1.23773 WP_005067306.1.2378 WP_005067306.1.2379 WP_005067306.1.2393 WP_005067306.1.24030 WP_005067306.1.24032 WP_005067306.1.24265 WP_005067306.1.24459 WP_005067306.1.24518 WP_005067306.1.24614 WP_005067306.1.24751 WP_005067306.1.24828 WP_005067306.1.2492 WP_005067306.1.24922 WP_005067306.1.25031 WP_005067306.1.25108 WP_005067306.1.25282 WP_005067306.1.25376 WP_005067306.1.25544 WP_005067306.1.25601 WP_005067306.1.25762 WP_005067306.1.2577 WP_005067306.1.25796 WP_005067306.1.25889 WP_005067306.1.25898 WP_005067306.1.26011 WP_005067306.1.26114 WP_005067306.1.26155 WP_005067306.1.26173 WP_005067306.1.26417 WP_005067306.1.26462 WP_005067306.1.27025 WP_005067306.1.27110 WP_005067306.1.27232 WP_005067306.1.27240 WP_005067306.1.27326 WP_005067306.1.27378 WP_005067306.1.27406 WP_005067306.1.27586 WP_005067306.1.27625 WP_005067306.1.27648 WP_005067306.1.27942 WP_005067306.1.27979 WP_005067306.1.28150 WP_005067306.1.28163 WP_005067306.1.28243 WP_005067306.1.28280 WP_005067306.1.28300 WP_005067306.1.2834 WP_005067306.1.28344 WP_005067306.1.28403 WP_005067306.1.28438 WP_005067306.1.2858 WP_005067306.1.28598 WP_005067306.1.28820 WP_005067306.1.28966 WP_005067306.1.29162 WP_005067306.1.29254 WP_005067306.1.29353 WP_005067306.1.29458 WP_005067306.1.29488 WP_005067306.1.29621 WP_005067306.1.29801 WP_005067306.1.30117 WP_005067306.1.30293 WP_005067306.1.30334 WP_005067306.1.30434 WP_005067306.1.30557 WP_005067306.1.30559 WP_005067306.1.30632 WP_005067306.1.30651 WP_005067306.1.30751 WP_005067306.1.30938 WP_005067306.1.31010 WP_005067306.1.31244 WP_005067306.1.31284 WP_005067306.1.31318 WP_005067306.1.31331 WP_005067306.1.31448 WP_005067306.1.31561 WP_005067306.1.31731 WP_005067306.1.31981 WP_005067306.1.32105 WP_005067306.1.32241 WP_005067306.1.32467 WP_005067306.1.32530 WP_005067306.1.32613 WP_005067306.1.32855 WP_005067306.1.32999 WP_005067306.1.33 WP_005067306.1.33207 WP_005067306.1.33439 WP_005067306.1.33462 WP_005067306.1.33577 WP_005067306.1.33619 WP_005067306.1.33770 WP_005067306.1.33858 WP_005067306.1.33863 WP_005067306.1.33928 WP_005067306.1.33998 WP_005067306.1.34101 WP_005067306.1.34166 WP_005067306.1.34432 WP_005067306.1.3453 WP_005067306.1.34687 WP_005067306.1.34752 WP_005067306.1.34770 WP_005067306.1.34802 WP_005067306.1.349 WP_005067306.1.34927 WP_005067306.1.34939 WP_005067306.1.34974 WP_005067306.1.34988 WP_005067306.1.35191 WP_005067306.1.35263 WP_005067306.1.35390 WP_005067306.1.35414 WP_005067306.1.35437 WP_005067306.1.35462 WP_005067306.1.35607 WP_005067306.1.35622 WP_005067306.1.35846 WP_005067306.1.36056 WP_005067306.1.36143 WP_005067306.1.36256 WP_005067306.1.36346 WP_005067306.1.36482 WP_005067306.1.36505 WP_005067306.1.36539 WP_005067306.1.36548 WP_005067306.1.36589 WP_005067306.1.36677 WP_005067306.1.36769 WP_005067306.1.36871 WP_005067306.1.36964 WP_005067306.1.37030 WP_005067306.1.3711 WP_005067306.1.37448 WP_005067306.1.37505 WP_005067306.1.37604 WP_005067306.1.37763 WP_005067306.1.37916 WP_005067306.1.37946 WP_005067306.1.37949 WP_005067306.1.38019 WP_005067306.1.38083 WP_005067306.1.38166 WP_005067306.1.38173 WP_005067306.1.38250 WP_005067306.1.38360 WP_005067306.1.38552 WP_005067306.1.38576 WP_005067306.1.38720 WP_005067306.1.38745 WP_005067306.1.38803 WP_005067306.1.38846 WP_005067306.1.38854 WP_005067306.1.3911 WP_005067306.1.39790 WP_005067306.1.39792 WP_005067306.1.39987 WP_005067306.1.40105 WP_005067306.1.40116 WP_005067306.1.40144 WP_005067306.1.40260 WP_005067306.1.4054 WP_005067306.1.40829 WP_005067306.1.4100 WP_005067306.1.41067 WP_005067306.1.41111 WP_005067306.1.41120 WP_005067306.1.41217 WP_005067306.1.4150 WP_005067306.1.41576 WP_005067306.1.41678 WP_005067306.1.41715 WP_005067306.1.4174 WP_005067306.1.41760 WP_005067306.1.41841 WP_005067306.1.41866 WP_005067306.1.42008 WP_005067306.1.42097 WP_005067306.1.42157 WP_005067306.1.42192 WP_005067306.1.42251 WP_005067306.1.42296 WP_005067306.1.42428 WP_005067306.1.42468 WP_005067306.1.42751 WP_005067306.1.42753 WP_005067306.1.42833 WP_005067306.1.42860 WP_005067306.1.42909 WP_005067306.1.43224 WP_005067306.1.43254 WP_005067306.1.43412 WP_005067306.1.43421 WP_005067306.1.43451 WP_005067306.1.43626 WP_005067306.1.4368 WP_005067306.1.43843 WP_005067306.1.43940 WP_005067306.1.43971 WP_005067306.1.43982 WP_005067306.1.4424 WP_005067306.1.44333 WP_005067306.1.44363 WP_005067306.1.44442 WP_005067306.1.44454 WP_005067306.1.44542 WP_005067306.1.44560 WP_005067306.1.44648 WP_005067306.1.44819 WP_005067306.1.45069 WP_005067306.1.45292 WP_005067306.1.45315 WP_005067306.1.45603 WP_005067306.1.46008 WP_005067306.1.4611 WP_005067306.1.4618 WP_005067306.1.46214 WP_005067306.1.46298 WP_005067306.1.46371 WP_005067306.1.46404 WP_005067306.1.46638 WP_005067306.1.46641 WP_005067306.1.47003 WP_005067306.1.47088 WP_005067306.1.47134 WP_005067306.1.4732 WP_005067306.1.47359 WP_005067306.1.47367 WP_005067306.1.47580 WP_005067306.1.47590 WP_005067306.1.47721 WP_005067306.1.47870 WP_005067306.1.48062 WP_005067306.1.48174 WP_005067306.1.48386 WP_005067306.1.48516 WP_005067306.1.48530 WP_005067306.1.4856 WP_005067306.1.4862 WP_005067306.1.48816 WP_005067306.1.49067 WP_005067306.1.49125 WP_005067306.1.49142 WP_005067306.1.49180 WP_005067306.1.49468 WP_005067306.1.498 WP_005067306.1.49908 WP_005067306.1.50040 WP_005067306.1.50079 WP_005067306.1.50140 WP_005067306.1.50203 WP_005067306.1.50524 WP_005067306.1.50671 WP_005067306.1.50738 WP_005067306.1.50749 WP_005067306.1.50916 WP_005067306.1.50946 WP_005067306.1.50973 WP_005067306.1.51292 WP_005067306.1.5130 WP_005067306.1.51350 WP_005067306.1.51442 WP_005067306.1.51577 WP_005067306.1.51759 WP_005067306.1.51905 WP_005067306.1.52022 WP_005067306.1.52141 WP_005067306.1.52265 WP_005067306.1.52379 WP_005067306.1.52471 WP_005067306.1.52661 WP_005067306.1.527 WP_005067306.1.52718 WP_005067306.1.52925 WP_005067306.1.53018 WP_005067306.1.53026 WP_005067306.1.53029 WP_005067306.1.53301 WP_005067306.1.53562 WP_005067306.1.53591 WP_005067306.1.53880 WP_005067306.1.53890 WP_005067306.1.54100 WP_005067306.1.54172 WP_005067306.1.54308 WP_005067306.1.54405 WP_005067306.1.5447 WP_005067306.1.54672 WP_005067306.1.54726 WP_005067306.1.54790 WP_005067306.1.54832 WP_005067306.1.5484 WP_005067306.1.54871 WP_005067306.1.5505 WP_005067306.1.55348 WP_005067306.1.5542 WP_005067306.1.55436 WP_005067306.1.55518 WP_005067306.1.55666 WP_005067306.1.55667 WP_005067306.1.55778 WP_005067306.1.55842 WP_005067306.1.55928 WP_005067306.1.55939 WP_005067306.1.56034 WP_005067306.1.56079 WP_005067306.1.5624 WP_005067306.1.56308 WP_005067306.1.56401 WP_005067306.1.5643 WP_005067306.1.56594 WP_005067306.1.56731 WP_005067306.1.56935 WP_005067306.1.57154 WP_005067306.1.57172 WP_005067306.1.57229 WP_005067306.1.57243 WP_005067306.1.5728 WP_005067306.1.57285 WP_005067306.1.5733 WP_005067306.1.57353 WP_005067306.1.57762 WP_005067306.1.57775 WP_005067306.1.57848 WP_005067306.1.58203 WP_005067306.1.58611 WP_005067306.1.58616 WP_005067306.1.58651 WP_005067306.1.58654 WP_005067306.1.58688 WP_005067306.1.5884 WP_005067306.1.58864 WP_005067306.1.59000 WP_005067306.1.5902 WP_005067306.1.59021 WP_005067306.1.59059 WP_005067306.1.59400 WP_005067306.1.59473 WP_005067306.1.59703 WP_005067306.1.59758 WP_005067306.1.59806 WP_005067306.1.59904 WP_005067306.1.59909 WP_005067306.1.59973 WP_005067306.1.60046 WP_005067306.1.60173 WP_005067306.1.60208 WP_005067306.1.60262 WP_005067306.1.60475 WP_005067306.1.60553 WP_005067306.1.60626 WP_005067306.1.60653 WP_005067306.1.6067 WP_005067306.1.60680 WP_005067306.1.60728 WP_005067306.1.60945 WP_005067306.1.60967 WP_005067306.1.6098 WP_005067306.1.61033 WP_005067306.1.61054 WP_005067306.1.61117 WP_005067306.1.61196 WP_005067306.1.61240 WP_005067306.1.61262 WP_005067306.1.61461 WP_005067306.1.61467 WP_005067306.1.61479 WP_005067306.1.61504 WP_005067306.1.61583 WP_005067306.1.61680 WP_005067306.1.61805 WP_005067306.1.6182 WP_005067306.1.61840 WP_005067306.1.61984 WP_005067306.1.62009 WP_005067306.1.62297 WP_005067306.1.62332 WP_005067306.1.62399 WP_005067306.1.62472 WP_005067306.1.63105 WP_005067306.1.63355 WP_005067306.1.63366 WP_005067306.1.63377 WP_005067306.1.63772 WP_005067306.1.64004 WP_005067306.1.64052 WP_005067306.1.64100 WP_005067306.1.64466 WP_005067306.1.64503 WP_005067306.1.64590 WP_005067306.1.64600 WP_005067306.1.64606 WP_005067306.1.64633 WP_005067306.1.6466 WP_005067306.1.64808 WP_005067306.1.65048 WP_005067306.1.65081 WP_005067306.1.65109 WP_005067306.1.65257 WP_005067306.1.65330 WP_005067306.1.65473 WP_005067306.1.65873 WP_005067306.1.65888 WP_005067306.1.66192 WP_005067306.1.66267 WP_005067306.1.66585 WP_005067306.1.66750 WP_005067306.1.66780 WP_005067306.1.66877 WP_005067306.1.6699 WP_005067306.1.67011 WP_005067306.1.67079 WP_005067306.1.67130 WP_005067306.1.67159 WP_005067306.1.67248 WP_005067306.1.67326 WP_005067306.1.67364 WP_005067306.1.67484 WP_005067306.1.6751 WP_005067306.1.67550 WP_005067306.1.67812 WP_005067306.1.67960 WP_005067306.1.67981 WP_005067306.1.68026 WP_005067306.1.6805 WP_005067306.1.68165 WP_005067306.1.68423 WP_005067306.1.68654 WP_005067306.1.68680 WP_005067306.1.68685 WP_005067306.1.69070 WP_005067306.1.69272 WP_005067306.1.69370 WP_005067306.1.69386 WP_005067306.1.69391 WP_005067306.1.69406 WP_005067306.1.69660 WP_005067306.1.69924 WP_005067306.1.70008 WP_005067306.1.70284 WP_005067306.1.70416 WP_005067306.1.70569 WP_005067306.1.70612 WP_005067306.1.70638 WP_005067306.1.70769 WP_005067306.1.7080 WP_005067306.1.71122 WP_005067306.1.71230 WP_005067306.1.71238 WP_005067306.1.71647 WP_005067306.1.71682 WP_005067306.1.71722 WP_005067306.1.71775 WP_005067306.1.71779 WP_005067306.1.72056 WP_005067306.1.72094 WP_005067306.1.72134 WP_005067306.1.72278 WP_005067306.1.72613 WP_005067306.1.72668 WP_005067306.1.73131 WP_005067306.1.73176 WP_005067306.1.73361 WP_005067306.1.73422 WP_005067306.1.73452 WP_005067306.1.73497 WP_005067306.1.7355 WP_005067306.1.73624 WP_005067306.1.73664 WP_005067306.1.73671 WP_005067306.1.73698 WP_005067306.1.73746 WP_005067306.1.73798 WP_005067306.1.73861 WP_005067306.1.74092 WP_005067306.1.74108 WP_005067306.1.74143 WP_005067306.1.7439 WP_005067306.1.7441 WP_005067306.1.74543 WP_005067306.1.74546 WP_005067306.1.74599 WP_005067306.1.74668 WP_005067306.1.74714 WP_005067306.1.74816 WP_005067306.1.7486 WP_005067306.1.74893 WP_005067306.1.74968 WP_005067306.1.74986 WP_005067306.1.75097 WP_005067306.1.75255 WP_005067306.1.75352 WP_005067306.1.75425 WP_005067306.1.7551 WP_005067306.1.75613 WP_005067306.1.75655 WP_005067306.1.75736 WP_005067306.1.76326 WP_005067306.1.76392 WP_005067306.1.7644 WP_005067306.1.76812 WP_005067306.1.76896 WP_005067306.1.77009 WP_005067306.1.77139 WP_005067306.1.77169 WP_005067306.1.77171 WP_005067306.1.77339 WP_005067306.1.77633 WP_005067306.1.77728 WP_005067306.1.7783 WP_005067306.1.77856 WP_005067306.1.77985 WP_005067306.1.78005 WP_005067306.1.7805 WP_005067306.1.78072 WP_005067306.1.78227 WP_005067306.1.78329 WP_005067306.1.78374 WP_005067306.1.78378 WP_005067306.1.78442 WP_005067306.1.78476 WP_005067306.1.78857 WP_005067306.1.78940 WP_005067306.1.79063 WP_005067306.1.79220 WP_005067306.1.79352 WP_005067306.1.7943 WP_005067306.1.79432 WP_005067306.1.79491 WP_005067306.1.79533 WP_005067306.1.79538 WP_005067306.1.79559 WP_005067306.1.80064 WP_005067306.1.8027 WP_005067306.1.80276 WP_005067306.1.80291 WP_005067306.1.80836 WP_005067306.1.80928 WP_005067306.1.81023 WP_005067306.1.81099 WP_005067306.1.81394 WP_005067306.1.81397 WP_005067306.1.81691 WP_005067306.1.82056 WP_005067306.1.82147 WP_005067306.1.82256 WP_005067306.1.82508 WP_005067306.1.82576 WP_005067306.1.82817 WP_005067306.1.82965 WP_005067306.1.8297 WP_005067306.1.83230 WP_005067306.1.83269 WP_005067306.1.83310 WP_005067306.1.8333 WP_005067306.1.83344 WP_005067306.1.83600 WP_005067306.1.83687 WP_005067306.1.83753 WP_005067306.1.83823 WP_005067306.1.83849 WP_005067306.1.83869 WP_005067306.1.84009 WP_005067306.1.841 WP_005067306.1.84132 WP_005067306.1.84301 WP_005067306.1.84346 WP_005067306.1.84386 WP_005067306.1.84733 WP_005067306.1.84810 WP_005067306.1.84862 WP_005067306.1.84870 WP_005067306.1.84882 WP_005067306.1.84928 WP_005067306.1.85050 WP_005067306.1.85345 WP_005067306.1.85448 WP_005067306.1.85644 WP_005067306.1.85664 WP_005067306.1.85949 WP_005067306.1.86064 WP_005067306.1.86071 WP_005067306.1.86121 WP_005067306.1.8628 WP_005067306.1.86417 WP_005067306.1.8659 WP_005067306.1.86623 WP_005067306.1.86854 WP_005067306.1.86862 WP_005067306.1.86974 WP_005067306.1.87049 WP_005067306.1.87080 WP_005067306.1.87103 WP_005067306.1.87181 WP_005067306.1.872 WP_005067306.1.87241 WP_005067306.1.87330 WP_005067306.1.87356 WP_005067306.1.87408 WP_005067306.1.8743 WP_005067306.1.87506 WP_005067306.1.87518 WP_005067306.1.87539 WP_005067306.1.87632 WP_005067306.1.87765 WP_005067306.1.88045 WP_005067306.1.88188 WP_005067306.1.88300 WP_005067306.1.88334 WP_005067306.1.88416 WP_005067306.1.88581 WP_005067306.1.88831 WP_005067306.1.88865 WP_005067306.1.89112 WP_005067306.1.89167 WP_005067306.1.89233 WP_005067306.1.89501 WP_005067306.1.89619 WP_005067306.1.89758 WP_005067306.1.90006 WP_005067306.1.90082 WP_005067306.1.90089 WP_005067306.1.90094 WP_005067306.1.90336 WP_005067306.1.90461 WP_005067306.1.90611 WP_005067306.1.90629 WP_005067306.1.90736 WP_005067306.1.90753 WP_005067306.1.90825 WP_005067306.1.91083 WP_005067306.1.91302 WP_005067306.1.91531 WP_005067306.1.91708 WP_005067306.1.91774 WP_005067306.1.91883 WP_005067306.1.92064 WP_005067306.1.92267 WP_005067306.1.92312 WP_005067306.1.92440 WP_005067306.1.92521 WP_005067306.1.92841 WP_005067306.1.93089 WP_005067306.1.93120 WP_005067306.1.93391 WP_005067306.1.93481 WP_005067306.1.93551 WP_005067306.1.93553 WP_005067306.1.93655 WP_005067306.1.93818 WP_005067306.1.93852 WP_005067306.1.94049 WP_005067306.1.94161 WP_005067306.1.9417 WP_005067306.1.94186 WP_005067306.1.94313 WP_005067306.1.94350 WP_005067306.1.94517 WP_005067306.1.94574 WP_005067306.1.9466 WP_005067306.1.94829 WP_005067306.1.94853 WP_005067306.1.9486 WP_005067306.1.94870 WP_005067306.1.95314 WP_005067306.1.95352 WP_005067306.1.95397 WP_005067306.1.95436 WP_005067306.1.95511 WP_005067306.1.9588 WP_005067306.1.95900 WP_005067306.1.95995 WP_005067306.1.96023 WP_005067306.1.96154 WP_005067306.1.96191 WP_005067306.1.9634 WP_005067306.1.96366 WP_005067306.1.96402 WP_005067306.1.96431 WP_005067306.1.96442 WP_005067306.1.9655 WP_005067306.1.9656 WP_005067306.1.96720 WP_005067306.1.96736 WP_005067306.1.96752 WP_005067306.1.96816 WP_005067306.1.97083 WP_005067306.1.97183 WP_005067306.1.9728 WP_005067306.1.97483 WP_005067306.1.97542 WP_005067306.1.97694 WP_005067306.1.97884 WP_005067306.1.97904 WP_005067306.1.97945 WP_005067306.1.98079 WP_005067306.1.9810 WP_005067306.1.98169 WP_005067306.1.98298 WP_005067306.1.98405 WP_005067306.1.98426 WP_005067306.1.98444 WP_005067306.1.98613 WP_005067306.1.99095 WP_005067306.1.99273 WP_005067306.1.99275 WP_005067306.1.99526 WP_005067306.1.99877 WP_005067306.1.99923 WP_005067306.1.99942 YP_001702579.1.21298 561007.MAB_1842c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]