SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169629189|ref|YP_001702838.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169629189|ref|YP_001702838.1|
Domain Number 1 Region: 14-171
Classification Level Classification E-value
Superfamily PEBP-like 9.29e-49
Family Prokaryotic PEBP-like proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169629189|ref|YP_001702838.1|
Sequence length 173
Comment Conserved hypothetical protein [Mycobacterium abscessus]
Sequence
MASPYDALPQLPTFTLTSASVTDGQPLSLDQVSGIMGAGGQDVSPELSWSGFPEETQSFA
VTVYDPDAPTASGFWHWAVANLPATVTQLPAGVGDGSGLPGDAITLANDASLKRYIGAAP
PAGHGPHRYYIAVHAVSVPKLELPENATPAYLGFNLFGHAIARAVIHGTYEQH
Download sequence
Identical sequences A0A0U1BET2 A0A1N0LI64 A0A1N3URJ5 A0A1T7H8D0 B1MPD3 R4UCY7 X8DU38 X8EUR3
gi|169629189|ref|YP_001702838.1| 561007.MAB_2103 gi|397679316|ref|YP_006520851.1| WP_005061118.1.100187 WP_005061118.1.100209 WP_005061118.1.100230 WP_005061118.1.100247 WP_005061118.1.100248 WP_005061118.1.100273 WP_005061118.1.10031 WP_005061118.1.10036 WP_005061118.1.100419 WP_005061118.1.100423 WP_005061118.1.10062 WP_005061118.1.100637 WP_005061118.1.100779 WP_005061118.1.100838 WP_005061118.1.101070 WP_005061118.1.10120 WP_005061118.1.101233 WP_005061118.1.101308 WP_005061118.1.101341 WP_005061118.1.101432 WP_005061118.1.101662 WP_005061118.1.101669 WP_005061118.1.101761 WP_005061118.1.101774 WP_005061118.1.10195 WP_005061118.1.102079 WP_005061118.1.102118 WP_005061118.1.10242 WP_005061118.1.10267 WP_005061118.1.10280 WP_005061118.1.10318 WP_005061118.1.10342 WP_005061118.1.10427 WP_005061118.1.10446 WP_005061118.1.1056 WP_005061118.1.10602 WP_005061118.1.10637 WP_005061118.1.10730 WP_005061118.1.10759 WP_005061118.1.10847 WP_005061118.1.1088 WP_005061118.1.10897 WP_005061118.1.11054 WP_005061118.1.11198 WP_005061118.1.1121 WP_005061118.1.11401 WP_005061118.1.11508 WP_005061118.1.11549 WP_005061118.1.11630 WP_005061118.1.1170 WP_005061118.1.11739 WP_005061118.1.11832 WP_005061118.1.11888 WP_005061118.1.11946 WP_005061118.1.11968 WP_005061118.1.12203 WP_005061118.1.12298 WP_005061118.1.12402 WP_005061118.1.12455 WP_005061118.1.125 WP_005061118.1.12509 WP_005061118.1.12515 WP_005061118.1.12577 WP_005061118.1.12593 WP_005061118.1.1265 WP_005061118.1.12695 WP_005061118.1.12716 WP_005061118.1.12850 WP_005061118.1.12894 WP_005061118.1.1296 WP_005061118.1.12971 WP_005061118.1.13146 WP_005061118.1.13300 WP_005061118.1.13439 WP_005061118.1.13518 WP_005061118.1.13688 WP_005061118.1.13703 WP_005061118.1.13767 WP_005061118.1.13789 WP_005061118.1.13890 WP_005061118.1.13978 WP_005061118.1.14019 WP_005061118.1.14052 WP_005061118.1.14278 WP_005061118.1.14308 WP_005061118.1.1460 WP_005061118.1.14685 WP_005061118.1.14802 WP_005061118.1.14836 WP_005061118.1.14912 WP_005061118.1.14940 WP_005061118.1.14988 WP_005061118.1.15031 WP_005061118.1.15084 WP_005061118.1.15348 WP_005061118.1.15388 WP_005061118.1.15400 WP_005061118.1.15406 WP_005061118.1.15662 WP_005061118.1.15682 WP_005061118.1.15721 WP_005061118.1.15804 WP_005061118.1.16211 WP_005061118.1.16250 WP_005061118.1.1637 WP_005061118.1.16469 WP_005061118.1.16491 WP_005061118.1.16496 WP_005061118.1.16615 WP_005061118.1.16629 WP_005061118.1.16644 WP_005061118.1.16789 WP_005061118.1.16865 WP_005061118.1.16906 WP_005061118.1.1694 WP_005061118.1.1695 WP_005061118.1.16984 WP_005061118.1.16989 WP_005061118.1.16991 WP_005061118.1.17 WP_005061118.1.17023 WP_005061118.1.1706 WP_005061118.1.17166 WP_005061118.1.17175 WP_005061118.1.17246 WP_005061118.1.17305 WP_005061118.1.17335 WP_005061118.1.17404 WP_005061118.1.1747 WP_005061118.1.17674 WP_005061118.1.17740 WP_005061118.1.17823 WP_005061118.1.17877 WP_005061118.1.1791 WP_005061118.1.18002 WP_005061118.1.1804 WP_005061118.1.18044 WP_005061118.1.18049 WP_005061118.1.18198 WP_005061118.1.18231 WP_005061118.1.18350 WP_005061118.1.18359 WP_005061118.1.18480 WP_005061118.1.18536 WP_005061118.1.18540 WP_005061118.1.18593 WP_005061118.1.18596 WP_005061118.1.18608 WP_005061118.1.18667 WP_005061118.1.18683 WP_005061118.1.18707 WP_005061118.1.18753 WP_005061118.1.18782 WP_005061118.1.18839 WP_005061118.1.18866 WP_005061118.1.19046 WP_005061118.1.19110 WP_005061118.1.19143 WP_005061118.1.19257 WP_005061118.1.19331 WP_005061118.1.19356 WP_005061118.1.1941 WP_005061118.1.19500 WP_005061118.1.19507 WP_005061118.1.19592 WP_005061118.1.19628 WP_005061118.1.19688 WP_005061118.1.19797 WP_005061118.1.19799 WP_005061118.1.19886 WP_005061118.1.19896 WP_005061118.1.19927 WP_005061118.1.19932 WP_005061118.1.20004 WP_005061118.1.20033 WP_005061118.1.20064 WP_005061118.1.20137 WP_005061118.1.20225 WP_005061118.1.20384 WP_005061118.1.20410 WP_005061118.1.20428 WP_005061118.1.20581 WP_005061118.1.2059 WP_005061118.1.20670 WP_005061118.1.20903 WP_005061118.1.21014 WP_005061118.1.21141 WP_005061118.1.21239 WP_005061118.1.21287 WP_005061118.1.21290 WP_005061118.1.21293 WP_005061118.1.21315 WP_005061118.1.21385 WP_005061118.1.21438 WP_005061118.1.21539 WP_005061118.1.21557 WP_005061118.1.21654 WP_005061118.1.21707 WP_005061118.1.21736 WP_005061118.1.2184 WP_005061118.1.22055 WP_005061118.1.22070 WP_005061118.1.22085 WP_005061118.1.22116 WP_005061118.1.22183 WP_005061118.1.2226 WP_005061118.1.22456 WP_005061118.1.22634 WP_005061118.1.2268 WP_005061118.1.22795 WP_005061118.1.22807 WP_005061118.1.22913 WP_005061118.1.23203 WP_005061118.1.23249 WP_005061118.1.23296 WP_005061118.1.23367 WP_005061118.1.23524 WP_005061118.1.2360 WP_005061118.1.23655 WP_005061118.1.23773 WP_005061118.1.2378 WP_005061118.1.2379 WP_005061118.1.23874 WP_005061118.1.2393 WP_005061118.1.23947 WP_005061118.1.24030 WP_005061118.1.24032 WP_005061118.1.2412 WP_005061118.1.24265 WP_005061118.1.24459 WP_005061118.1.2448 WP_005061118.1.24518 WP_005061118.1.24564 WP_005061118.1.24614 WP_005061118.1.24751 WP_005061118.1.24821 WP_005061118.1.24828 WP_005061118.1.2492 WP_005061118.1.24922 WP_005061118.1.24932 WP_005061118.1.24973 WP_005061118.1.25108 WP_005061118.1.2523 WP_005061118.1.25282 WP_005061118.1.25376 WP_005061118.1.25468 WP_005061118.1.25535 WP_005061118.1.25544 WP_005061118.1.25586 WP_005061118.1.25601 WP_005061118.1.25653 WP_005061118.1.25672 WP_005061118.1.25762 WP_005061118.1.2577 WP_005061118.1.25778 WP_005061118.1.25796 WP_005061118.1.25884 WP_005061118.1.25889 WP_005061118.1.25898 WP_005061118.1.25900 WP_005061118.1.26011 WP_005061118.1.26069 WP_005061118.1.26114 WP_005061118.1.26155 WP_005061118.1.26173 WP_005061118.1.26417 WP_005061118.1.2646 WP_005061118.1.26462 WP_005061118.1.26684 WP_005061118.1.26996 WP_005061118.1.27025 WP_005061118.1.27031 WP_005061118.1.27110 WP_005061118.1.27232 WP_005061118.1.27326 WP_005061118.1.27378 WP_005061118.1.27406 WP_005061118.1.27499 WP_005061118.1.27586 WP_005061118.1.27625 WP_005061118.1.27648 WP_005061118.1.27784 WP_005061118.1.27895 WP_005061118.1.27942 WP_005061118.1.27979 WP_005061118.1.28129 WP_005061118.1.28150 WP_005061118.1.28163 WP_005061118.1.28243 WP_005061118.1.28280 WP_005061118.1.28286 WP_005061118.1.28300 WP_005061118.1.2834 WP_005061118.1.28344 WP_005061118.1.28403 WP_005061118.1.28438 WP_005061118.1.2858 WP_005061118.1.28598 WP_005061118.1.28820 WP_005061118.1.28966 WP_005061118.1.2898 WP_005061118.1.29162 WP_005061118.1.29254 WP_005061118.1.29353 WP_005061118.1.29458 WP_005061118.1.29482 WP_005061118.1.29488 WP_005061118.1.29621 WP_005061118.1.29801 WP_005061118.1.30071 WP_005061118.1.30117 WP_005061118.1.30285 WP_005061118.1.30293 WP_005061118.1.30334 WP_005061118.1.30434 WP_005061118.1.30449 WP_005061118.1.3048 WP_005061118.1.30557 WP_005061118.1.30559 WP_005061118.1.30577 WP_005061118.1.30632 WP_005061118.1.30651 WP_005061118.1.30751 WP_005061118.1.30938 WP_005061118.1.31010 WP_005061118.1.31072 WP_005061118.1.31118 WP_005061118.1.31244 WP_005061118.1.31258 WP_005061118.1.31284 WP_005061118.1.31318 WP_005061118.1.31331 WP_005061118.1.31415 WP_005061118.1.31448 WP_005061118.1.31561 WP_005061118.1.31687 WP_005061118.1.31731 WP_005061118.1.31788 WP_005061118.1.31981 WP_005061118.1.32026 WP_005061118.1.32105 WP_005061118.1.32241 WP_005061118.1.32467 WP_005061118.1.32530 WP_005061118.1.32613 WP_005061118.1.32766 WP_005061118.1.32855 WP_005061118.1.32993 WP_005061118.1.32999 WP_005061118.1.33 WP_005061118.1.33207 WP_005061118.1.33411 WP_005061118.1.33439 WP_005061118.1.33462 WP_005061118.1.33548 WP_005061118.1.33568 WP_005061118.1.33577 WP_005061118.1.33619 WP_005061118.1.33672 WP_005061118.1.33721 WP_005061118.1.33770 WP_005061118.1.33858 WP_005061118.1.33863 WP_005061118.1.33928 WP_005061118.1.33998 WP_005061118.1.34087 WP_005061118.1.34095 WP_005061118.1.34101 WP_005061118.1.34166 WP_005061118.1.34268 WP_005061118.1.34432 WP_005061118.1.34518 WP_005061118.1.3466 WP_005061118.1.34687 WP_005061118.1.34725 WP_005061118.1.34752 WP_005061118.1.34770 WP_005061118.1.34802 WP_005061118.1.349 WP_005061118.1.34927 WP_005061118.1.34939 WP_005061118.1.34974 WP_005061118.1.34987 WP_005061118.1.34988 WP_005061118.1.35004 WP_005061118.1.35041 WP_005061118.1.35191 WP_005061118.1.35263 WP_005061118.1.35375 WP_005061118.1.35390 WP_005061118.1.35414 WP_005061118.1.35437 WP_005061118.1.35607 WP_005061118.1.35622 WP_005061118.1.35745 WP_005061118.1.35808 WP_005061118.1.35846 WP_005061118.1.3587 WP_005061118.1.35941 WP_005061118.1.36043 WP_005061118.1.36056 WP_005061118.1.36143 WP_005061118.1.36256 WP_005061118.1.36296 WP_005061118.1.3631 WP_005061118.1.36346 WP_005061118.1.36452 WP_005061118.1.36464 WP_005061118.1.36482 WP_005061118.1.36505 WP_005061118.1.36539 WP_005061118.1.36548 WP_005061118.1.36589 WP_005061118.1.36625 WP_005061118.1.36650 WP_005061118.1.36677 WP_005061118.1.36744 WP_005061118.1.36769 WP_005061118.1.36855 WP_005061118.1.36871 WP_005061118.1.36924 WP_005061118.1.36964 WP_005061118.1.37017 WP_005061118.1.37030 WP_005061118.1.3711 WP_005061118.1.37349 WP_005061118.1.3736 WP_005061118.1.37402 WP_005061118.1.37448 WP_005061118.1.37505 WP_005061118.1.37595 WP_005061118.1.37604 WP_005061118.1.37670 WP_005061118.1.37704 WP_005061118.1.37763 WP_005061118.1.37768 WP_005061118.1.37785 WP_005061118.1.37873 WP_005061118.1.37916 WP_005061118.1.37928 WP_005061118.1.37946 WP_005061118.1.37949 WP_005061118.1.38005 WP_005061118.1.38019 WP_005061118.1.38083 WP_005061118.1.38166 WP_005061118.1.38173 WP_005061118.1.38250 WP_005061118.1.38298 WP_005061118.1.38360 WP_005061118.1.38552 WP_005061118.1.38570 WP_005061118.1.38576 WP_005061118.1.38720 WP_005061118.1.38745 WP_005061118.1.38803 WP_005061118.1.38846 WP_005061118.1.38854 WP_005061118.1.38954 WP_005061118.1.3911 WP_005061118.1.39187 WP_005061118.1.39231 WP_005061118.1.3946 WP_005061118.1.39574 WP_005061118.1.39612 WP_005061118.1.39628 WP_005061118.1.3969 WP_005061118.1.39707 WP_005061118.1.39744 WP_005061118.1.39790 WP_005061118.1.39792 WP_005061118.1.39885 WP_005061118.1.39987 WP_005061118.1.40102 WP_005061118.1.40105 WP_005061118.1.40116 WP_005061118.1.40144 WP_005061118.1.40222 WP_005061118.1.40260 WP_005061118.1.40477 WP_005061118.1.4054 WP_005061118.1.40929 WP_005061118.1.4100 WP_005061118.1.4104 WP_005061118.1.41056 WP_005061118.1.41067 WP_005061118.1.41081 WP_005061118.1.41111 WP_005061118.1.41120 WP_005061118.1.41217 WP_005061118.1.41485 WP_005061118.1.4150 WP_005061118.1.41576 WP_005061118.1.41595 WP_005061118.1.41678 WP_005061118.1.41691 WP_005061118.1.41715 WP_005061118.1.4174 WP_005061118.1.41760 WP_005061118.1.41841 WP_005061118.1.41843 WP_005061118.1.41866 WP_005061118.1.42008 WP_005061118.1.42039 WP_005061118.1.42097 WP_005061118.1.42157 WP_005061118.1.42175 WP_005061118.1.42186 WP_005061118.1.42192 WP_005061118.1.42251 WP_005061118.1.42274 WP_005061118.1.42296 WP_005061118.1.42428 WP_005061118.1.42468 WP_005061118.1.42751 WP_005061118.1.42753 WP_005061118.1.42833 WP_005061118.1.42860 WP_005061118.1.42875 WP_005061118.1.42895 WP_005061118.1.42909 WP_005061118.1.42915 WP_005061118.1.43004 WP_005061118.1.43071 WP_005061118.1.43117 WP_005061118.1.43171 WP_005061118.1.43178 WP_005061118.1.43224 WP_005061118.1.43254 WP_005061118.1.43355 WP_005061118.1.43365 WP_005061118.1.43397 WP_005061118.1.43402 WP_005061118.1.43412 WP_005061118.1.43421 WP_005061118.1.43626 WP_005061118.1.43629 WP_005061118.1.43631 WP_005061118.1.4368 WP_005061118.1.43718 WP_005061118.1.43843 WP_005061118.1.43971 WP_005061118.1.43982 WP_005061118.1.4424 WP_005061118.1.44333 WP_005061118.1.44363 WP_005061118.1.44442 WP_005061118.1.44454 WP_005061118.1.44542 WP_005061118.1.44560 WP_005061118.1.44648 WP_005061118.1.44819 WP_005061118.1.45069 WP_005061118.1.45085 WP_005061118.1.45292 WP_005061118.1.45315 WP_005061118.1.45603 WP_005061118.1.45677 WP_005061118.1.45824 WP_005061118.1.46008 WP_005061118.1.4611 WP_005061118.1.46142 WP_005061118.1.4618 WP_005061118.1.46214 WP_005061118.1.46265 WP_005061118.1.46298 WP_005061118.1.46371 WP_005061118.1.46390 WP_005061118.1.46404 WP_005061118.1.46638 WP_005061118.1.46641 WP_005061118.1.46844 WP_005061118.1.46960 WP_005061118.1.47003 WP_005061118.1.47088 WP_005061118.1.47134 WP_005061118.1.47229 WP_005061118.1.47233 WP_005061118.1.47271 WP_005061118.1.4732 WP_005061118.1.47324 WP_005061118.1.47359 WP_005061118.1.47367 WP_005061118.1.47418 WP_005061118.1.47491 WP_005061118.1.47580 WP_005061118.1.47590 WP_005061118.1.47597 WP_005061118.1.47601 WP_005061118.1.47713 WP_005061118.1.47721 WP_005061118.1.47757 WP_005061118.1.47870 WP_005061118.1.47915 WP_005061118.1.4793 WP_005061118.1.48032 WP_005061118.1.48062 WP_005061118.1.48079 WP_005061118.1.48159 WP_005061118.1.48174 WP_005061118.1.4828 WP_005061118.1.48302 WP_005061118.1.48386 WP_005061118.1.48458 WP_005061118.1.48516 WP_005061118.1.48530 WP_005061118.1.4856 WP_005061118.1.48640 WP_005061118.1.4874 WP_005061118.1.48816 WP_005061118.1.48895 WP_005061118.1.48914 WP_005061118.1.4893 WP_005061118.1.48940 WP_005061118.1.49067 WP_005061118.1.49125 WP_005061118.1.49142 WP_005061118.1.49180 WP_005061118.1.49292 WP_005061118.1.49468 WP_005061118.1.4954 WP_005061118.1.498 WP_005061118.1.49908 WP_005061118.1.50020 WP_005061118.1.50040 WP_005061118.1.50079 WP_005061118.1.50140 WP_005061118.1.50203 WP_005061118.1.50402 WP_005061118.1.50524 WP_005061118.1.50620 WP_005061118.1.50671 WP_005061118.1.50738 WP_005061118.1.50749 WP_005061118.1.50855 WP_005061118.1.50909 WP_005061118.1.50916 WP_005061118.1.50946 WP_005061118.1.50973 WP_005061118.1.51108 WP_005061118.1.51292 WP_005061118.1.5130 WP_005061118.1.51350 WP_005061118.1.51442 WP_005061118.1.51577 WP_005061118.1.51595 WP_005061118.1.51604 WP_005061118.1.51759 WP_005061118.1.51905 WP_005061118.1.52022 WP_005061118.1.52084 WP_005061118.1.52141 WP_005061118.1.52265 WP_005061118.1.52300 WP_005061118.1.52379 WP_005061118.1.5254 WP_005061118.1.52636 WP_005061118.1.52661 WP_005061118.1.5267 WP_005061118.1.527 WP_005061118.1.52718 WP_005061118.1.528 WP_005061118.1.52925 WP_005061118.1.53018 WP_005061118.1.53026 WP_005061118.1.53029 WP_005061118.1.53120 WP_005061118.1.53301 WP_005061118.1.53358 WP_005061118.1.5339 WP_005061118.1.53468 WP_005061118.1.53562 WP_005061118.1.53591 WP_005061118.1.53765 WP_005061118.1.53876 WP_005061118.1.53880 WP_005061118.1.53890 WP_005061118.1.54100 WP_005061118.1.54149 WP_005061118.1.54172 WP_005061118.1.54308 WP_005061118.1.54326 WP_005061118.1.54405 WP_005061118.1.54443 WP_005061118.1.5447 WP_005061118.1.54520 WP_005061118.1.54672 WP_005061118.1.54726 WP_005061118.1.54790 WP_005061118.1.54832 WP_005061118.1.5484 WP_005061118.1.54871 WP_005061118.1.55017 WP_005061118.1.55036 WP_005061118.1.5505 WP_005061118.1.55348 WP_005061118.1.5542 WP_005061118.1.55436 WP_005061118.1.55518 WP_005061118.1.55601 WP_005061118.1.55666 WP_005061118.1.55778 WP_005061118.1.55842 WP_005061118.1.55928 WP_005061118.1.55939 WP_005061118.1.56034 WP_005061118.1.56079 WP_005061118.1.56143 WP_005061118.1.5624 WP_005061118.1.56308 WP_005061118.1.56401 WP_005061118.1.5643 WP_005061118.1.56594 WP_005061118.1.56609 WP_005061118.1.56672 WP_005061118.1.56731 WP_005061118.1.56891 WP_005061118.1.56935 WP_005061118.1.56938 WP_005061118.1.57172 WP_005061118.1.5721 WP_005061118.1.57229 WP_005061118.1.57243 WP_005061118.1.57258 WP_005061118.1.5728 WP_005061118.1.57285 WP_005061118.1.5733 WP_005061118.1.57353 WP_005061118.1.57762 WP_005061118.1.57775 WP_005061118.1.57848 WP_005061118.1.5792 WP_005061118.1.57967 WP_005061118.1.58203 WP_005061118.1.58256 WP_005061118.1.58611 WP_005061118.1.58616 WP_005061118.1.58651 WP_005061118.1.58654 WP_005061118.1.58688 WP_005061118.1.58716 WP_005061118.1.58773 WP_005061118.1.58826 WP_005061118.1.5884 WP_005061118.1.59000 WP_005061118.1.5902 WP_005061118.1.59021 WP_005061118.1.59050 WP_005061118.1.59059 WP_005061118.1.59400 WP_005061118.1.59436 WP_005061118.1.59473 WP_005061118.1.59544 WP_005061118.1.59634 WP_005061118.1.59703 WP_005061118.1.59758 WP_005061118.1.59806 WP_005061118.1.59904 WP_005061118.1.59909 WP_005061118.1.59941 WP_005061118.1.59946 WP_005061118.1.59947 WP_005061118.1.59973 WP_005061118.1.60046 WP_005061118.1.60173 WP_005061118.1.60208 WP_005061118.1.60260 WP_005061118.1.60262 WP_005061118.1.60273 WP_005061118.1.60315 WP_005061118.1.60354 WP_005061118.1.60456 WP_005061118.1.60475 WP_005061118.1.60522 WP_005061118.1.60553 WP_005061118.1.6062 WP_005061118.1.60626 WP_005061118.1.60653 WP_005061118.1.6067 WP_005061118.1.60728 WP_005061118.1.60945 WP_005061118.1.60967 WP_005061118.1.6098 WP_005061118.1.61033 WP_005061118.1.61054 WP_005061118.1.61063 WP_005061118.1.61066 WP_005061118.1.61117 WP_005061118.1.61125 WP_005061118.1.61196 WP_005061118.1.61240 WP_005061118.1.61262 WP_005061118.1.61461 WP_005061118.1.61467 WP_005061118.1.61479 WP_005061118.1.61504 WP_005061118.1.61583 WP_005061118.1.61678 WP_005061118.1.61680 WP_005061118.1.61744 WP_005061118.1.61805 WP_005061118.1.6182 WP_005061118.1.61840 WP_005061118.1.61984 WP_005061118.1.62009 WP_005061118.1.62297 WP_005061118.1.62332 WP_005061118.1.62399 WP_005061118.1.62472 WP_005061118.1.62515 WP_005061118.1.62556 WP_005061118.1.62588 WP_005061118.1.62827 WP_005061118.1.62893 WP_005061118.1.63105 WP_005061118.1.63355 WP_005061118.1.63366 WP_005061118.1.63377 WP_005061118.1.63648 WP_005061118.1.63772 WP_005061118.1.63790 WP_005061118.1.63861 WP_005061118.1.63965 WP_005061118.1.64052 WP_005061118.1.64100 WP_005061118.1.64324 WP_005061118.1.64466 WP_005061118.1.64503 WP_005061118.1.64590 WP_005061118.1.64600 WP_005061118.1.64606 WP_005061118.1.64633 WP_005061118.1.64635 WP_005061118.1.6466 WP_005061118.1.64808 WP_005061118.1.65048 WP_005061118.1.65081 WP_005061118.1.65109 WP_005061118.1.65216 WP_005061118.1.65257 WP_005061118.1.65330 WP_005061118.1.65605 WP_005061118.1.65615 WP_005061118.1.65825 WP_005061118.1.65873 WP_005061118.1.65888 WP_005061118.1.66000 WP_005061118.1.6607 WP_005061118.1.66192 WP_005061118.1.66267 WP_005061118.1.66585 WP_005061118.1.66750 WP_005061118.1.66780 WP_005061118.1.66859 WP_005061118.1.66877 WP_005061118.1.6699 WP_005061118.1.66992 WP_005061118.1.67011 WP_005061118.1.67079 WP_005061118.1.67082 WP_005061118.1.67130 WP_005061118.1.67159 WP_005061118.1.67248 WP_005061118.1.67326 WP_005061118.1.67337 WP_005061118.1.67364 WP_005061118.1.67484 WP_005061118.1.67485 WP_005061118.1.6751 WP_005061118.1.67550 WP_005061118.1.67812 WP_005061118.1.67960 WP_005061118.1.67981 WP_005061118.1.68014 WP_005061118.1.68026 WP_005061118.1.68035 WP_005061118.1.6805 WP_005061118.1.68165 WP_005061118.1.68198 WP_005061118.1.68419 WP_005061118.1.68423 WP_005061118.1.68500 WP_005061118.1.68654 WP_005061118.1.68680 WP_005061118.1.68685 WP_005061118.1.68968 WP_005061118.1.69070 WP_005061118.1.69075 WP_005061118.1.69092 WP_005061118.1.69272 WP_005061118.1.69370 WP_005061118.1.69386 WP_005061118.1.69391 WP_005061118.1.69406 WP_005061118.1.69660 WP_005061118.1.69853 WP_005061118.1.69924 WP_005061118.1.69956 WP_005061118.1.70008 WP_005061118.1.7004 WP_005061118.1.70111 WP_005061118.1.70212 WP_005061118.1.70284 WP_005061118.1.70416 WP_005061118.1.70479 WP_005061118.1.70569 WP_005061118.1.70612 WP_005061118.1.70638 WP_005061118.1.70769 WP_005061118.1.7080 WP_005061118.1.70902 WP_005061118.1.70925 WP_005061118.1.70946 WP_005061118.1.71122 WP_005061118.1.71152 WP_005061118.1.71190 WP_005061118.1.71230 WP_005061118.1.71238 WP_005061118.1.71374 WP_005061118.1.71647 WP_005061118.1.71682 WP_005061118.1.71722 WP_005061118.1.71775 WP_005061118.1.71779 WP_005061118.1.71784 WP_005061118.1.71968 WP_005061118.1.72056 WP_005061118.1.72094 WP_005061118.1.72134 WP_005061118.1.72278 WP_005061118.1.72320 WP_005061118.1.72613 WP_005061118.1.72668 WP_005061118.1.72851 WP_005061118.1.7306 WP_005061118.1.73131 WP_005061118.1.73176 WP_005061118.1.73361 WP_005061118.1.73415 WP_005061118.1.73422 WP_005061118.1.73452 WP_005061118.1.73460 WP_005061118.1.73497 WP_005061118.1.7355 WP_005061118.1.73624 WP_005061118.1.73632 WP_005061118.1.73670 WP_005061118.1.73671 WP_005061118.1.73698 WP_005061118.1.73746 WP_005061118.1.73788 WP_005061118.1.73798 WP_005061118.1.73861 WP_005061118.1.74063 WP_005061118.1.74092 WP_005061118.1.74108 WP_005061118.1.7414 WP_005061118.1.74143 WP_005061118.1.74336 WP_005061118.1.7439 WP_005061118.1.7441 WP_005061118.1.74413 WP_005061118.1.74493 WP_005061118.1.74505 WP_005061118.1.74543 WP_005061118.1.74546 WP_005061118.1.74599 WP_005061118.1.74662 WP_005061118.1.74668 WP_005061118.1.74714 WP_005061118.1.74816 WP_005061118.1.74893 WP_005061118.1.74968 WP_005061118.1.74986 WP_005061118.1.75079 WP_005061118.1.75097 WP_005061118.1.75255 WP_005061118.1.75352 WP_005061118.1.75372 WP_005061118.1.75425 WP_005061118.1.75495 WP_005061118.1.7551 WP_005061118.1.75613 WP_005061118.1.75655 WP_005061118.1.75662 WP_005061118.1.75730 WP_005061118.1.75736 WP_005061118.1.76048 WP_005061118.1.76084 WP_005061118.1.76326 WP_005061118.1.76353 WP_005061118.1.76389 WP_005061118.1.76392 WP_005061118.1.7644 WP_005061118.1.76494 WP_005061118.1.76789 WP_005061118.1.76812 WP_005061118.1.76842 WP_005061118.1.76870 WP_005061118.1.76896 WP_005061118.1.76949 WP_005061118.1.77009 WP_005061118.1.77139 WP_005061118.1.77169 WP_005061118.1.77171 WP_005061118.1.77270 WP_005061118.1.77339 WP_005061118.1.77461 WP_005061118.1.77633 WP_005061118.1.77728 WP_005061118.1.7783 WP_005061118.1.77985 WP_005061118.1.78005 WP_005061118.1.7805 WP_005061118.1.78055 WP_005061118.1.78072 WP_005061118.1.78213 WP_005061118.1.78227 WP_005061118.1.78329 WP_005061118.1.78374 WP_005061118.1.78378 WP_005061118.1.78391 WP_005061118.1.78442 WP_005061118.1.78476 WP_005061118.1.78665 WP_005061118.1.78857 WP_005061118.1.78940 WP_005061118.1.78997 WP_005061118.1.79063 WP_005061118.1.7922 WP_005061118.1.79220 WP_005061118.1.79352 WP_005061118.1.7943 WP_005061118.1.79432 WP_005061118.1.79491 WP_005061118.1.79533 WP_005061118.1.79538 WP_005061118.1.79559 WP_005061118.1.79843 WP_005061118.1.80064 WP_005061118.1.80108 WP_005061118.1.8027 WP_005061118.1.80276 WP_005061118.1.80291 WP_005061118.1.80323 WP_005061118.1.80489 WP_005061118.1.8082 WP_005061118.1.80836 WP_005061118.1.80912 WP_005061118.1.80928 WP_005061118.1.81023 WP_005061118.1.81053 WP_005061118.1.81099 WP_005061118.1.8139 WP_005061118.1.81394 WP_005061118.1.81397 WP_005061118.1.81450 WP_005061118.1.81691 WP_005061118.1.81783 WP_005061118.1.81797 WP_005061118.1.81901 WP_005061118.1.81953 WP_005061118.1.820 WP_005061118.1.82056 WP_005061118.1.82102 WP_005061118.1.82147 WP_005061118.1.82196 WP_005061118.1.82204 WP_005061118.1.82256 WP_005061118.1.8231 WP_005061118.1.82457 WP_005061118.1.82508 WP_005061118.1.82576 WP_005061118.1.82817 WP_005061118.1.82849 WP_005061118.1.82852 WP_005061118.1.82965 WP_005061118.1.8297 WP_005061118.1.83230 WP_005061118.1.83269 WP_005061118.1.83310 WP_005061118.1.8333 WP_005061118.1.83344 WP_005061118.1.83488 WP_005061118.1.83521 WP_005061118.1.83600 WP_005061118.1.83610 WP_005061118.1.83687 WP_005061118.1.83717 WP_005061118.1.83753 WP_005061118.1.83823 WP_005061118.1.83849 WP_005061118.1.83869 WP_005061118.1.84009 WP_005061118.1.84018 WP_005061118.1.8402 WP_005061118.1.84094 WP_005061118.1.841 WP_005061118.1.84132 WP_005061118.1.84206 WP_005061118.1.84239 WP_005061118.1.84296 WP_005061118.1.84301 WP_005061118.1.84346 WP_005061118.1.84386 WP_005061118.1.84400 WP_005061118.1.84574 WP_005061118.1.84733 WP_005061118.1.84788 WP_005061118.1.84798 WP_005061118.1.84810 WP_005061118.1.84862 WP_005061118.1.84870 WP_005061118.1.84882 WP_005061118.1.84928 WP_005061118.1.85006 WP_005061118.1.85046 WP_005061118.1.85050 WP_005061118.1.85337 WP_005061118.1.85345 WP_005061118.1.85448 WP_005061118.1.85573 WP_005061118.1.85626 WP_005061118.1.85644 WP_005061118.1.85664 WP_005061118.1.85949 WP_005061118.1.8604 WP_005061118.1.86064 WP_005061118.1.86071 WP_005061118.1.8611 WP_005061118.1.86121 WP_005061118.1.8628 WP_005061118.1.86417 WP_005061118.1.86491 WP_005061118.1.86521 WP_005061118.1.8659 WP_005061118.1.86623 WP_005061118.1.86854 WP_005061118.1.86862 WP_005061118.1.86917 WP_005061118.1.86938 WP_005061118.1.87049 WP_005061118.1.87080 WP_005061118.1.87103 WP_005061118.1.87124 WP_005061118.1.87128 WP_005061118.1.87181 WP_005061118.1.872 WP_005061118.1.87241 WP_005061118.1.87330 WP_005061118.1.87356 WP_005061118.1.87408 WP_005061118.1.8743 WP_005061118.1.87506 WP_005061118.1.87518 WP_005061118.1.87539 WP_005061118.1.87569 WP_005061118.1.87632 WP_005061118.1.87765 WP_005061118.1.87785 WP_005061118.1.87814 WP_005061118.1.87974 WP_005061118.1.88010 WP_005061118.1.88045 WP_005061118.1.88100 WP_005061118.1.88188 WP_005061118.1.88287 WP_005061118.1.88300 WP_005061118.1.88334 WP_005061118.1.88416 WP_005061118.1.88581 WP_005061118.1.88721 WP_005061118.1.88813 WP_005061118.1.88831 WP_005061118.1.88865 WP_005061118.1.88868 WP_005061118.1.89005 WP_005061118.1.89015 WP_005061118.1.89104 WP_005061118.1.89112 WP_005061118.1.89167 WP_005061118.1.89233 WP_005061118.1.8939 WP_005061118.1.8948 WP_005061118.1.89501 WP_005061118.1.89619 WP_005061118.1.89758 WP_005061118.1.9000 WP_005061118.1.90006 WP_005061118.1.90089 WP_005061118.1.90094 WP_005061118.1.90336 WP_005061118.1.90461 WP_005061118.1.90611 WP_005061118.1.90629 WP_005061118.1.90736 WP_005061118.1.90753 WP_005061118.1.90825 WP_005061118.1.91083 WP_005061118.1.91136 WP_005061118.1.9116 WP_005061118.1.91302 WP_005061118.1.91517 WP_005061118.1.91531 WP_005061118.1.91669 WP_005061118.1.91677 WP_005061118.1.91708 WP_005061118.1.91727 WP_005061118.1.91774 WP_005061118.1.9178 WP_005061118.1.91819 WP_005061118.1.91883 WP_005061118.1.91945 WP_005061118.1.9201 WP_005061118.1.92064 WP_005061118.1.92267 WP_005061118.1.92312 WP_005061118.1.92366 WP_005061118.1.92440 WP_005061118.1.92514 WP_005061118.1.92521 WP_005061118.1.92709 WP_005061118.1.92841 WP_005061118.1.92927 WP_005061118.1.93024 WP_005061118.1.93089 WP_005061118.1.93120 WP_005061118.1.93391 WP_005061118.1.93433 WP_005061118.1.93481 WP_005061118.1.93551 WP_005061118.1.93553 WP_005061118.1.93655 WP_005061118.1.93818 WP_005061118.1.93852 WP_005061118.1.93931 WP_005061118.1.94049 WP_005061118.1.94161 WP_005061118.1.9417 WP_005061118.1.94186 WP_005061118.1.9425 WP_005061118.1.94295 WP_005061118.1.94313 WP_005061118.1.94350 WP_005061118.1.94472 WP_005061118.1.94485 WP_005061118.1.94517 WP_005061118.1.94574 WP_005061118.1.94627 WP_005061118.1.9466 WP_005061118.1.94706 WP_005061118.1.94757 WP_005061118.1.94829 WP_005061118.1.94853 WP_005061118.1.9486 WP_005061118.1.94870 WP_005061118.1.94937 WP_005061118.1.9507 WP_005061118.1.95131 WP_005061118.1.95283 WP_005061118.1.95314 WP_005061118.1.95352 WP_005061118.1.95397 WP_005061118.1.95436 WP_005061118.1.95511 WP_005061118.1.95572 WP_005061118.1.95766 WP_005061118.1.9588 WP_005061118.1.95900 WP_005061118.1.95995 WP_005061118.1.96023 WP_005061118.1.96064 WP_005061118.1.96154 WP_005061118.1.96191 WP_005061118.1.96196 WP_005061118.1.9634 WP_005061118.1.96366 WP_005061118.1.96402 WP_005061118.1.96431 WP_005061118.1.96442 WP_005061118.1.96459 WP_005061118.1.9655 WP_005061118.1.9656 WP_005061118.1.96599 WP_005061118.1.96630 WP_005061118.1.96720 WP_005061118.1.96736 WP_005061118.1.96752 WP_005061118.1.96816 WP_005061118.1.97083 WP_005061118.1.97105 WP_005061118.1.97183 WP_005061118.1.9728 WP_005061118.1.97420 WP_005061118.1.97483 WP_005061118.1.97542 WP_005061118.1.97572 WP_005061118.1.97694 WP_005061118.1.97884 WP_005061118.1.97904 WP_005061118.1.97909 WP_005061118.1.97945 WP_005061118.1.98079 WP_005061118.1.98169 WP_005061118.1.98269 WP_005061118.1.98298 WP_005061118.1.98405 WP_005061118.1.98426 WP_005061118.1.98437 WP_005061118.1.98444 WP_005061118.1.98487 WP_005061118.1.98613 WP_005061118.1.9871 WP_005061118.1.98867 WP_005061118.1.98878 WP_005061118.1.99095 WP_005061118.1.99112 WP_005061118.1.99141 WP_005061118.1.99273 WP_005061118.1.99275 WP_005061118.1.99441 WP_005061118.1.99526 WP_005061118.1.99679 WP_005061118.1.99848 WP_005061118.1.99877 WP_005061118.1.99911 WP_005061118.1.99923 WP_005061118.1.99942 WP_005061118.1.99957 YP_001702838.1.21298 gi|507420968|ref|YP_008022492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]