SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169630987|ref|YP_001704636.1| from Mycobacterium abscessus ATCC 19977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169630987|ref|YP_001704636.1|
Domain Number 1 Region: 47-360
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.58e-46
Family Heme-dependent catalases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169630987|ref|YP_001704636.1|
Sequence length 374
Comment Conserved hypothetical protein [Mycobacterium abscessus]
Sequence
MSESGELLDAQRSYLRYRDDMAVAPPGEEEVIDRIIRVLHKNNERAYQKYRHGVRDAHAK
SHAVLRGELTVYPDLEPELRQGMFATPGTYPVVVRLSSTSGALRSDKVRGVRGLGIKVLG
VDGPRTLPDDDATTQDFVMVTHREFLFADAREYLRKGMPTAWLIARLSDTALAGGARVLG
AIAKCLSRIGISIPETVTVFVRPNVHILGDTFYSSAPLRFGDYVAKLQYVPLSPSVAELK
DKPLSDDVDDDVFRHMIAEFFRTHSAEYELQAQLCTDVKKMPLEDATVAWPEELSPHRPI
AKITFPVQDSYSAQRRAYGDDVLSYNSWRALEAHRPLGSINRLKLRVYEASSNFRHDKNM
VPRVEPARAEEIPD
Download sequence
Identical sequences A0A1M8WRE8 A0A2C9Y2S3 B1MHA1 X8E577
WP_005061524.1.100273 WP_005061524.1.10031 WP_005061524.1.10036 WP_005061524.1.10062 WP_005061524.1.100637 WP_005061524.1.100779 WP_005061524.1.101070 WP_005061524.1.10120 WP_005061524.1.101233 WP_005061524.1.101308 WP_005061524.1.101432 WP_005061524.1.101662 WP_005061524.1.101669 WP_005061524.1.101761 WP_005061524.1.10342 WP_005061524.1.10427 WP_005061524.1.10602 WP_005061524.1.10637 WP_005061524.1.10730 WP_005061524.1.10759 WP_005061524.1.10847 WP_005061524.1.1088 WP_005061524.1.10897 WP_005061524.1.11054 WP_005061524.1.11888 WP_005061524.1.12298 WP_005061524.1.12455 WP_005061524.1.125 WP_005061524.1.1265 WP_005061524.1.12850 WP_005061524.1.13146 WP_005061524.1.13300 WP_005061524.1.13439 WP_005061524.1.13518 WP_005061524.1.13767 WP_005061524.1.13789 WP_005061524.1.13890 WP_005061524.1.13978 WP_005061524.1.14802 WP_005061524.1.14988 WP_005061524.1.15406 WP_005061524.1.15662 WP_005061524.1.15721 WP_005061524.1.16250 WP_005061524.1.1637 WP_005061524.1.16629 WP_005061524.1.16789 WP_005061524.1.17023 WP_005061524.1.17166 WP_005061524.1.17175 WP_005061524.1.17246 WP_005061524.1.17404 WP_005061524.1.1747 WP_005061524.1.17823 WP_005061524.1.1791 WP_005061524.1.18359 WP_005061524.1.18593 WP_005061524.1.18839 WP_005061524.1.19046 WP_005061524.1.19110 WP_005061524.1.19143 WP_005061524.1.19257 WP_005061524.1.19356 WP_005061524.1.1941 WP_005061524.1.19500 WP_005061524.1.19507 WP_005061524.1.19628 WP_005061524.1.19799 WP_005061524.1.19886 WP_005061524.1.19932 WP_005061524.1.20064 WP_005061524.1.20137 WP_005061524.1.2059 WP_005061524.1.20670 WP_005061524.1.20903 WP_005061524.1.21293 WP_005061524.1.21315 WP_005061524.1.21438 WP_005061524.1.2145 WP_005061524.1.21539 WP_005061524.1.2184 WP_005061524.1.22055 WP_005061524.1.22070 WP_005061524.1.22085 WP_005061524.1.22116 WP_005061524.1.2226 WP_005061524.1.2268 WP_005061524.1.22807 WP_005061524.1.22913 WP_005061524.1.23296 WP_005061524.1.2360 WP_005061524.1.23947 WP_005061524.1.24030 WP_005061524.1.2412 WP_005061524.1.24459 WP_005061524.1.2448 WP_005061524.1.24518 WP_005061524.1.24564 WP_005061524.1.2492 WP_005061524.1.24973 WP_005061524.1.25031 WP_005061524.1.25468 WP_005061524.1.25535 WP_005061524.1.25544 WP_005061524.1.25601 WP_005061524.1.26011 WP_005061524.1.26114 WP_005061524.1.26173 WP_005061524.1.26382 WP_005061524.1.26417 WP_005061524.1.2646 WP_005061524.1.26996 WP_005061524.1.27240 WP_005061524.1.27378 WP_005061524.1.27406 WP_005061524.1.27648 WP_005061524.1.27784 WP_005061524.1.27942 WP_005061524.1.27979 WP_005061524.1.28150 WP_005061524.1.28286 WP_005061524.1.28344 WP_005061524.1.28438 WP_005061524.1.28598 WP_005061524.1.28820 WP_005061524.1.2898 WP_005061524.1.29254 WP_005061524.1.29621 WP_005061524.1.29801 WP_005061524.1.30071 WP_005061524.1.30117 WP_005061524.1.30334 WP_005061524.1.30449 WP_005061524.1.30559 WP_005061524.1.30577 WP_005061524.1.30632 WP_005061524.1.30651 WP_005061524.1.31118 WP_005061524.1.31258 WP_005061524.1.31284 WP_005061524.1.31331 WP_005061524.1.31415 WP_005061524.1.31731 WP_005061524.1.31788 WP_005061524.1.31981 WP_005061524.1.32026 WP_005061524.1.32105 WP_005061524.1.32766 WP_005061524.1.32999 WP_005061524.1.33117 WP_005061524.1.33411 WP_005061524.1.33462 WP_005061524.1.33548 WP_005061524.1.33568 WP_005061524.1.33672 WP_005061524.1.33858 WP_005061524.1.34087 WP_005061524.1.34095 WP_005061524.1.34166 WP_005061524.1.34518 WP_005061524.1.34687 WP_005061524.1.34725 WP_005061524.1.349 WP_005061524.1.34927 WP_005061524.1.34988 WP_005061524.1.35041 WP_005061524.1.35390 WP_005061524.1.35414 WP_005061524.1.35437 WP_005061524.1.35462 WP_005061524.1.35808 WP_005061524.1.3587 WP_005061524.1.36143 WP_005061524.1.36452 WP_005061524.1.36548 WP_005061524.1.36589 WP_005061524.1.36677 WP_005061524.1.36855 WP_005061524.1.36871 WP_005061524.1.37017 WP_005061524.1.37030 WP_005061524.1.3711 WP_005061524.1.37349 WP_005061524.1.37505 WP_005061524.1.37768 WP_005061524.1.37785 WP_005061524.1.37928 WP_005061524.1.37946 WP_005061524.1.38005 WP_005061524.1.38019 WP_005061524.1.38298 WP_005061524.1.38576 WP_005061524.1.38720 WP_005061524.1.38745 WP_005061524.1.38854 WP_005061524.1.38954 WP_005061524.1.39187 WP_005061524.1.39574 WP_005061524.1.39628 WP_005061524.1.39707 WP_005061524.1.39744 WP_005061524.1.39792 WP_005061524.1.39885 WP_005061524.1.39987 WP_005061524.1.40222 WP_005061524.1.40477 WP_005061524.1.4054 WP_005061524.1.40829 WP_005061524.1.4100 WP_005061524.1.41056 WP_005061524.1.41120 WP_005061524.1.41217 WP_005061524.1.41595 WP_005061524.1.41691 WP_005061524.1.41715 WP_005061524.1.4174 WP_005061524.1.41760 WP_005061524.1.41841 WP_005061524.1.41866 WP_005061524.1.42039 WP_005061524.1.42175 WP_005061524.1.42186 WP_005061524.1.42296 WP_005061524.1.42468 WP_005061524.1.42753 WP_005061524.1.42860 WP_005061524.1.42875 WP_005061524.1.42895 WP_005061524.1.43117 WP_005061524.1.43171 WP_005061524.1.43254 WP_005061524.1.43397 WP_005061524.1.43412 WP_005061524.1.43451 WP_005061524.1.43940 WP_005061524.1.43982 WP_005061524.1.44363 WP_005061524.1.45069 WP_005061524.1.45085 WP_005061524.1.45194 WP_005061524.1.45292 WP_005061524.1.45677 WP_005061524.1.45824 WP_005061524.1.46142 WP_005061524.1.4618 WP_005061524.1.46214 WP_005061524.1.46298 WP_005061524.1.46390 WP_005061524.1.46844 WP_005061524.1.46960 WP_005061524.1.4732 WP_005061524.1.47324 WP_005061524.1.47491 WP_005061524.1.47590 WP_005061524.1.47757 WP_005061524.1.47915 WP_005061524.1.48062 WP_005061524.1.48079 WP_005061524.1.48254 WP_005061524.1.4828 WP_005061524.1.48302 WP_005061524.1.48458 WP_005061524.1.48530 WP_005061524.1.4856 WP_005061524.1.4862 WP_005061524.1.48895 WP_005061524.1.48914 WP_005061524.1.4893 WP_005061524.1.49067 WP_005061524.1.49292 WP_005061524.1.4954 WP_005061524.1.49908 WP_005061524.1.50140 WP_005061524.1.50203 WP_005061524.1.50524 WP_005061524.1.50620 WP_005061524.1.50738 WP_005061524.1.50749 WP_005061524.1.50855 WP_005061524.1.50909 WP_005061524.1.51350 WP_005061524.1.51442 WP_005061524.1.51595 WP_005061524.1.52300 WP_005061524.1.52379 WP_005061524.1.52471 WP_005061524.1.52476 WP_005061524.1.5254 WP_005061524.1.52636 WP_005061524.1.5267 WP_005061524.1.528 WP_005061524.1.52925 WP_005061524.1.53120 WP_005061524.1.53301 WP_005061524.1.53468 WP_005061524.1.53644 WP_005061524.1.53765 WP_005061524.1.53890 WP_005061524.1.54100 WP_005061524.1.54172 WP_005061524.1.54308 WP_005061524.1.54326 WP_005061524.1.54405 WP_005061524.1.5447 WP_005061524.1.54520 WP_005061524.1.54790 WP_005061524.1.5484 WP_005061524.1.55017 WP_005061524.1.5505 WP_005061524.1.5542 WP_005061524.1.55518 WP_005061524.1.55601 WP_005061524.1.55666 WP_005061524.1.55667 WP_005061524.1.56034 WP_005061524.1.56143 WP_005061524.1.5624 WP_005061524.1.56308 WP_005061524.1.56401 WP_005061524.1.5643 WP_005061524.1.56609 WP_005061524.1.56938 WP_005061524.1.57154 WP_005061524.1.5721 WP_005061524.1.57229 WP_005061524.1.5733 WP_005061524.1.57775 WP_005061524.1.57848 WP_005061524.1.5792 WP_005061524.1.57967 WP_005061524.1.58203 WP_005061524.1.58256 WP_005061524.1.58611 WP_005061524.1.58688 WP_005061524.1.58716 WP_005061524.1.58826 WP_005061524.1.58864 WP_005061524.1.59000 WP_005061524.1.59021 WP_005061524.1.59400 WP_005061524.1.59544 WP_005061524.1.59758 WP_005061524.1.59909 WP_005061524.1.59946 WP_005061524.1.59947 WP_005061524.1.59973 WP_005061524.1.60273 WP_005061524.1.60354 WP_005061524.1.60456 WP_005061524.1.6067 WP_005061524.1.60680 WP_005061524.1.61033 WP_005061524.1.61125 WP_005061524.1.61196 WP_005061524.1.61262 WP_005061524.1.61461 WP_005061524.1.61467 WP_005061524.1.61583 WP_005061524.1.61680 WP_005061524.1.62332 WP_005061524.1.62399 WP_005061524.1.62556 WP_005061524.1.62827 WP_005061524.1.63457 WP_005061524.1.63648 WP_005061524.1.63790 WP_005061524.1.63965 WP_005061524.1.64004 WP_005061524.1.64052 WP_005061524.1.64466 WP_005061524.1.64503 WP_005061524.1.64600 WP_005061524.1.64606 WP_005061524.1.64633 WP_005061524.1.64808 WP_005061524.1.65081 WP_005061524.1.65216 WP_005061524.1.65257 WP_005061524.1.65330 WP_005061524.1.65473 WP_005061524.1.65615 WP_005061524.1.65825 WP_005061524.1.65873 WP_005061524.1.66000 WP_005061524.1.6607 WP_005061524.1.66192 WP_005061524.1.66585 WP_005061524.1.66859 WP_005061524.1.66992 WP_005061524.1.67011 WP_005061524.1.67082 WP_005061524.1.67159 WP_005061524.1.67248 WP_005061524.1.67337 WP_005061524.1.67364 WP_005061524.1.67960 WP_005061524.1.68014 WP_005061524.1.68026 WP_005061524.1.68035 WP_005061524.1.6805 WP_005061524.1.68419 WP_005061524.1.68968 WP_005061524.1.69070 WP_005061524.1.69092 WP_005061524.1.69272 WP_005061524.1.69391 WP_005061524.1.69886 WP_005061524.1.69956 WP_005061524.1.70008 WP_005061524.1.7004 WP_005061524.1.70212 WP_005061524.1.70479 WP_005061524.1.70569 WP_005061524.1.70612 WP_005061524.1.70769 WP_005061524.1.70925 WP_005061524.1.70946 WP_005061524.1.71152 WP_005061524.1.71190 WP_005061524.1.71374 WP_005061524.1.71647 WP_005061524.1.72094 WP_005061524.1.72134 WP_005061524.1.72320 WP_005061524.1.72613 WP_005061524.1.72851 WP_005061524.1.73176 WP_005061524.1.73422 WP_005061524.1.7355 WP_005061524.1.73624 WP_005061524.1.73632 WP_005061524.1.73664 WP_005061524.1.74092 WP_005061524.1.7414 WP_005061524.1.74143 WP_005061524.1.74413 WP_005061524.1.74493 WP_005061524.1.74505 WP_005061524.1.74543 WP_005061524.1.74599 WP_005061524.1.74662 WP_005061524.1.74815 WP_005061524.1.7486 WP_005061524.1.74986 WP_005061524.1.75079 WP_005061524.1.75097 WP_005061524.1.75495 WP_005061524.1.76326 WP_005061524.1.76353 WP_005061524.1.7644 WP_005061524.1.76789 WP_005061524.1.76842 WP_005061524.1.76870 WP_005061524.1.76896 WP_005061524.1.76949 WP_005061524.1.77009 WP_005061524.1.77270 WP_005061524.1.77633 WP_005061524.1.77728 WP_005061524.1.77856 WP_005061524.1.78005 WP_005061524.1.78055 WP_005061524.1.78072 WP_005061524.1.78213 WP_005061524.1.78329 WP_005061524.1.78374 WP_005061524.1.78391 WP_005061524.1.78665 WP_005061524.1.78857 WP_005061524.1.78940 WP_005061524.1.78997 WP_005061524.1.79063 WP_005061524.1.7922 WP_005061524.1.79352 WP_005061524.1.7943 WP_005061524.1.79432 WP_005061524.1.79533 WP_005061524.1.79843 WP_005061524.1.80108 WP_005061524.1.8027 WP_005061524.1.80291 WP_005061524.1.80836 WP_005061524.1.80912 WP_005061524.1.81397 WP_005061524.1.81691 WP_005061524.1.81953 WP_005061524.1.820 WP_005061524.1.82056 WP_005061524.1.82204 WP_005061524.1.82256 WP_005061524.1.8231 WP_005061524.1.82508 WP_005061524.1.82817 WP_005061524.1.82849 WP_005061524.1.82852 WP_005061524.1.83488 WP_005061524.1.83600 WP_005061524.1.83610 WP_005061524.1.83753 WP_005061524.1.83823 WP_005061524.1.83869 WP_005061524.1.84018 WP_005061524.1.84094 WP_005061524.1.84132 WP_005061524.1.84239 WP_005061524.1.84296 WP_005061524.1.84386 WP_005061524.1.84400 WP_005061524.1.84733 WP_005061524.1.84788 WP_005061524.1.84798 WP_005061524.1.84870 WP_005061524.1.84882 WP_005061524.1.85006 WP_005061524.1.85046 WP_005061524.1.85448 WP_005061524.1.8604 WP_005061524.1.86071 WP_005061524.1.8628 WP_005061524.1.86491 WP_005061524.1.86521 WP_005061524.1.86623 WP_005061524.1.86862 WP_005061524.1.86917 WP_005061524.1.86938 WP_005061524.1.86974 WP_005061524.1.87049 WP_005061524.1.87080 WP_005061524.1.87103 WP_005061524.1.872 WP_005061524.1.87356 WP_005061524.1.88010 WP_005061524.1.88300 WP_005061524.1.88334 WP_005061524.1.88581 WP_005061524.1.88831 WP_005061524.1.88945 WP_005061524.1.89104 WP_005061524.1.89167 WP_005061524.1.89501 WP_005061524.1.89581 WP_005061524.1.9000 WP_005061524.1.90082 WP_005061524.1.90336 WP_005061524.1.90611 WP_005061524.1.90629 WP_005061524.1.90825 WP_005061524.1.91136 WP_005061524.1.9116 WP_005061524.1.91517 WP_005061524.1.91531 WP_005061524.1.91883 WP_005061524.1.91945 WP_005061524.1.92366 WP_005061524.1.92514 WP_005061524.1.92709 WP_005061524.1.92841 WP_005061524.1.92927 WP_005061524.1.93391 WP_005061524.1.93481 WP_005061524.1.93553 WP_005061524.1.93655 WP_005061524.1.93931 WP_005061524.1.94186 WP_005061524.1.9425 WP_005061524.1.94295 WP_005061524.1.94472 WP_005061524.1.94485 WP_005061524.1.94627 WP_005061524.1.94706 WP_005061524.1.94757 WP_005061524.1.94829 WP_005061524.1.9486 WP_005061524.1.9507 WP_005061524.1.95314 WP_005061524.1.95397 WP_005061524.1.95436 WP_005061524.1.95511 WP_005061524.1.9588 WP_005061524.1.95900 WP_005061524.1.95995 WP_005061524.1.96191 WP_005061524.1.96196 WP_005061524.1.96366 WP_005061524.1.96459 WP_005061524.1.9655 WP_005061524.1.96599 WP_005061524.1.96630 WP_005061524.1.96736 WP_005061524.1.97105 WP_005061524.1.97483 WP_005061524.1.97572 WP_005061524.1.97904 WP_005061524.1.97945 WP_005061524.1.9810 WP_005061524.1.98169 WP_005061524.1.98269 WP_005061524.1.98298 WP_005061524.1.98405 WP_005061524.1.98444 WP_005061524.1.98613 WP_005061524.1.9871 WP_005061524.1.98878 WP_005061524.1.99112 WP_005061524.1.99141 WP_005061524.1.99273 WP_005061524.1.99275 WP_005061524.1.99526 WP_005061524.1.99848 WP_005061524.1.99877 WP_005061524.1.99942 WP_005061524.1.99957 YP_001704636.1.21298 gi|169630987|ref|YP_001704636.1| 561007.MAB_3908c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]