SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167040357|ref|YP_001663342.1| from Thermoanaerobacter sp. X514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167040357|ref|YP_001663342.1|
Domain Number 1 Region: 18-178
Classification Level Classification E-value
Superfamily RNase III domain-like 1.13e-52
Family RNase III catalytic domain-like 0.0000354
Further Details:      
 
Domain Number 2 Region: 129-246
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.38e-25
Family Double-stranded RNA-binding domain (dsRBD) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|167040357|ref|YP_001663342.1|
Sequence length 246
Comment ribonuclease III [Thermoanaerobacter sp. X514]
Sequence
MGHYFLKNFKRGMEVKRENLSELEERINYSFKDKNLLIEALTHSSWAHEGKNSKISNERL
EFLGDSVLSLVISEYLYKNRKDLEEGSLSKYRAEIVCEPSLARCAREIELGNFLRIGKGE
ELTGGRERDSILADAMEAILAAVYLDGGLEVVRNVILELFKNIIEEVLEGLIYRDYKTKL
QEVVQSMEIGKIIYELIEEMGPDHNKTFVTQVRIGDVILGKGYGKSKKEAEQAAAMEALI
KLGILK
Download sequence
Identical sequences A0A101D686 A0A101FD56 B0K1V8 C7IPC1
gi|307724323|ref|YP_003904074.1| 399726.Teth514_1720 gi|167040357|ref|YP_001663342.1| WP_003866670.1.26562 WP_003866670.1.47445 WP_003866670.1.81593 WP_003866670.1.95568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]