SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167039172|ref|YP_001662157.1| from Thermoanaerobacter sp. X514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167039172|ref|YP_001662157.1|
Domain Number 1 Region: 183-374
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.64e-86
Family GroEL-like chaperone, apical domain 0.000000717
Further Details:      
 
Domain Number 2 Region: 5-133,404-521
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 3.58e-82
Family GroEL chaperone, ATPase domain 0.00000473
Further Details:      
 
Domain Number 3 Region: 136-203
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.27e-27
Family GroEL-like chaperone, intermediate domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|167039172|ref|YP_001662157.1|
Sequence length 541
Comment chaperonin GroEL [Thermoanaerobacter sp. X514]
Sequence
MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGSPTVTNDGVTIAREIE
LEDPFENQGAQLLKEVATKTNDVAGDGTTTATLLAQAMVREGLKNLAAGANPMLLRRGIA
KAVDAAVEGLKRISKPIDNKESIAHVASISAADEEIGNLIAEAMDKVGKDGVITVEESKT
LGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITDKKLSNIQDLLPLLEQVVQ
HGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGDRRKEMLQDIAILTGGQVIS
EELGYDLKDVRLDMLGRARQVKVTKENTTIVGGAGDAAEIKKRVNQIKAQIEETTSDYDR
EKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALAATKAAVEEGIVPGGGIALLNV
IEDVQKVVDSLDGDFKTGAKIVLRALEEPVRQIAANAGVDGSVIVEKIKAAKDPNFGYDA
YKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTTEAVVVDVPEKNTAMPNPGAGMDM
M
Download sequence
Identical sequences B0K3P6 B0KBR3 C7IPX7 E8UVX1
gi|167038116|ref|YP_001665694.1| gi|307723753|ref|YP_003903504.1| gi|167039172|ref|YP_001662157.1| gi|320116522|ref|YP_004186681.1| WP_003866816.1.26562 WP_003866816.1.2934 WP_003866816.1.47445 WP_003866816.1.56562 WP_003866816.1.81593 WP_003866816.1.95568 340099.Teth39_1721 399726.Teth514_0513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]