SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|167039343|ref|YP_001662328.1| from Thermoanaerobacter sp. X514

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|167039343|ref|YP_001662328.1|
Domain Number 1 Region: 248-432
Classification Level Classification E-value
Superfamily TPR-like 4.17e-31
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 2 Region: 88-238
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000202
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000619
Family SinR domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|167039343|ref|YP_001662328.1|
Sequence length 436
Comment hypothetical protein Teth514_0685 [Thermoanaerobacter sp. X514]
Sequence
MDMVELGKRIREERKRQFLKQGDLSGDEFSKGYISLIEKGKISPSLKALNFIAQKLNKPV
VYFLDEDYVEKEELKKELAKYKNILEKFLTAQKAFDNKNYEEAIKLYIDILDNAIDEYST
NLINFYLAKSYFAIKDYTKVLEILDKISPYFEKSSLNEIIVEMHYMKGLCLGNLQKFQSS
LENYLKALDGFEKYSLKHTQLKSRILYSIANLYSKMGEFIKARDYYMKCLEYSTQIKAVD
FIALSNNGLGLVNHELKQYKDALKYIRRAILISKTLNLKEDIANEYNYLGFVYTDLKKYD
IAEKYFVKSYSLYKDLGNERGMAYNLTEIGRIYYLKEDYPKALEYLNQSLEIVTKLGEEE
EMGRIYTILGNLHLKQGQFELSEKELLKSVEILKTLGLKKDLSEAYKGLGNLYIALNNPE
EAKKYFNQSIELLYEN
Download sequence
Identical sequences A0A117KKA9 B0K4Q3 C7ITY1
gi|307725334|ref|YP_003905085.1| gi|167039343|ref|YP_001662328.1| 399726.Teth514_0685 WP_003868280.1.26562 WP_003868280.1.47445 WP_003868280.1.81593 WP_003868280.1.95568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]