SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169834513|ref|YP_001693820.1| from Streptococcus pneumoniae Hungary19A-6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169834513|ref|YP_001693820.1|
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 1.09e-48
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00018
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.09e-28
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169834513|ref|YP_001693820.1|
Sequence length 270
Comment bifunctional folate synthesis protein [Streptococcus pneumoniae Hungary19A-6]
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFTNQVVEVET
WLPAQVLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQTLYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences B1I919
WP_000372534.1.37623 WP_000372534.1.3864 WP_000372534.1.79671 487214.SPH_0409 gi|169834513|ref|YP_001693820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]