SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170757535|ref|YP_001780789.1| from Clostridium botulinum B1 str. Okra

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170757535|ref|YP_001780789.1|
Domain Number 1 Region: 91-351,388-534
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.09e-42
Family AAT-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170757535|ref|YP_001780789.1|
Sequence length 547
Comment aspartate aminotransferase [Clostridium botulinum B1 str. Okra]
Sequence
MDNPNIQRIELEHIYGKISPFELKDRLISLAKESQIEKSAHALLDAGRGNPNWTAAAPRE
AFFAFGQFAVEETRRVWSDGALAGMPKKEGIYKRFREYIEKHKREPGIELLNNIVHYGIE
VKEFDEDCFVYELADGIIGDNYPVPDRMLIHIEKVVQDYLMQEMCYNKPLKGEFNLFAVE
GATAAMCYIFDSLIANELLQRGDRIALMTPIFTPYLEIPLIPRYNFEVVKISATETKEDG
THTWQYPDEELEKLRDSSIKALFVVNPSNPPSVAIKSDSINKIVQIVNESNPNLMIISDD
VYGTFVDEFRSLVADLAFNTIGVYSFSKYFGVTGWRLGTIALYEENVFDKLIRELPKEKK
EALRKRYGALSTNPEEILFIDRIVADSRQVALNHTAGLSTPQQVQMAFFSVFAILDKENK
YKQLTQQICRRRQKLLYEGLGIKFEREENDASYYTEFDLLQWAHCNYGEDFGAYLEKNYK
PVDILLRLAEKSSIVLLGGGGFHGPEWSIRISLANLNDEAYSKIGKVLHNVLDEYVKEWK
CYRNLQK
Download sequence
Identical sequences B1IIW3 B1KZC2
WP_012343074.1.21789 WP_012343074.1.9908 gi|170759648|ref|YP_001786549.1| gi|170757535|ref|YP_001780789.1| 498213.CLD_3403 498214.CLK_0601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]