SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169823732|ref|YP_001691343.1| from Finegoldia magna ATCC 29328

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169823732|ref|YP_001691343.1|
Domain Number 1 Region: 155-198,227-393,537-654
Classification Level Classification E-value
Superfamily Subtilisin-like 4.58e-63
Family Subtilases 0.00065
Further Details:      
 
Domain Number 2 Region: 425-530
Classification Level Classification E-value
Superfamily PA domain 0.000000000000575
Family PA domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169823732|ref|YP_001691343.1|
Sequence length 1960
Comment cell wall-associated serine proteinase [Finegoldia magna ATCC 29328]
Sequence
MKPYSKKFLAGVLLFSLALPSATTFATNQTDSTTYAKLQEQGVKADQEVKVIVETSDKTA
IEREPNVKSARFSKAVKASEAEVKKTSEKIETKLKKENVKVDKDDEFSAVITGFSAKVKA
KDIDKLRKQPGVKKVTTQMKAERPKVGASPSLASAPKMIKADTLWDSKYNFTGQGMLISI
IDTGVDPTHKDIQLESNDFQKYKSKEDVQKVIDANKLKGKWFSNKIPYGYNYADESQEIR
DSGIGGYHGMHVAGIVAANGNTETGGVRGVAPNAQLLAMKVFSNDALVSTVYEEVWLKAI
DDSVKLGADVLNMSLGMGSGYSREGVSPTNDAFKRAKKAGVVCAVAMGNDRVTNWGGEGK
TNLAINPDFGTTGHPAVADPSYSVASMENINMRGRVVEYKDNDKVVEIPTGTAEGENEKT
TTGMLPFVYVGKGNDQKKDYGDKVVKNKIVLAERGGASFNDKAELAASLGAKGIIIFNSK
DGSNLSFMSGMENKDFPSVFISHDDGLKLIELLKKPNQLINITKVQSVANPKAGQMSEFS
SWGITPDLRLKPDIAGVGGQIYSTINNNQYTMMSGTSMATPQVAGASALVMQRLYKDGLL
VRKDGKPDPRQEFLTVLVMMNTATPIKDTEVKGASYYTPKQQGAGLVNLKNVAETYVTVT
ATGGKDTKPDGKLELGEVGEDFKATFKLKNYSDKDITFTPKYISLKDEVKDGRYTEHSSE
VKKETLPKVTVKAKSEVTYTATISTDKIDKNQFAQGYVMFESDTDHPTLSVPYTGFKGNW
SQPQFLDNMPDFSDKVNYKPLVYDNGGIDKSGFMRRQEKGGWNYWNAWNVDGKPTVFVNS
NKQEGMNVEVAPVITIMRNALDVKYDILDKDGKTLRNLFIDPILLKVNGLYKGGDNQYRF
EYVPGGAAWDFKDSKGKPVEEGNYIYQITGHVDYKNAKEQKYQYNIVLDNTAPKLKGTYN
PEKGTITVTAHDDGSGVFSVGYENIKTGEWHEQQVREDHRYDDIGIVRDYSYEFKIADGF
DLANLSIYAWDNARNVDGKDVDTQVKSSDVQIDPIKIMVGDPVPTEEQVKKQIKAKVKDI
PENAEFKILRNIENTEKPGEFTIVVSVKNGEEQTNYTVPVKVEAIKPIELKVGDKPLITE
QVKAHLDFLPKDAKVRIVKNVDTKEPGEFGLKVEVKIDGKKIYYTIPVIVKAEEKKEEKP
EEKPEEKQEVKDQTVYNLPVIKVENPDYYAAFGKYEDEKNPDAYKKIHVKGNVTKIKQLD
HLTLTITKDGKKVEGTEVQEIKVNKEGDSNFSFDHELDISNLEDGSVYELQIKAEGENVR
GDGIQDTIIRRIRKDFVAPTVEYTVEHKDEKAPMAKIKVKGHENMTYLEMYLDGNMLSRV
DKTWDNFELKEGVDGEFEVEVPLEVGENKFQIKAYDDAGNETLQEVVINRKDPNEKDPVN
TKELADNMLKANSIVSVSEKYDVTDEQIAELKKLIEEAKTAITEQQPQDKVDAVNKKLTD
ALAKIKEKEVKKVDKKQLIGQKEDAQNLLDKKEVKLTDEQQKALQDLIKKAEDLTKKEDA
TQEEVDKLAKEIKDEIAKIQEAGKENPTKPGKEDPTKPGKEDPTKPGKEDPTKPGKEDPT
KPGKEDPTKPGKEDPTKPGKEDPTKPGKENPANPGTTTPSVPGTPTPAPKTPAQTTKATT
RVAGVDRINTAVEVSKKYYNSAETVIIANYEKFADSLSASALSKALKAPILLVQKDQLDS
VVAQEINRLGAKNVVVIGGDHSVDKAKNSLAKYNVQTIAGSDRYETSAKIAQEIIKRTGT
TQAVIASGETFADALTVAPLANKHNMPILLVQPNNIPKATQEVLKQINKVIIVGGEKTIS
NEVANKLPNPTRIAGANRYETAKKIYEYGFKDRKEVNIANGTNFADSLVIGSIDCPILLA
ESNEVPESTKQAIKDSKFEKVNVFGGENSIGESVVKELIK
Download sequence
Identical sequences B0S433
334413.FMG_0035 gi|169823732|ref|YP_001691343.1| WP_012290121.1.74057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]