SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169824159|ref|YP_001691770.1| from Finegoldia magna ATCC 29328

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169824159|ref|YP_001691770.1|
Domain Number 1 Region: 5-283
Classification Level Classification E-value
Superfamily Folate-binding domain 1.04e-98
Family Aminomethyltransferase folate-binding domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 280-365
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 3.11e-19
Family Aminomethyltransferase beta-barrel domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|169824159|ref|YP_001691770.1|
Sequence length 366
Comment glycine cleavage system T protein [Finegoldia magna ATCC 29328]
Sequence
MLMSTKKTPLYEEHKKLGGKVVDFAGFYLPVDYEGLQQEHEAVRNSVGLFDVSHMGEFTV
KGKDALKFINYVCTNDYSKCADGQIQYSLLLHEDGGMVDDLLVYKNNDEDFLMVPNAANT
EKDFKHISKYVDKFDVELKNISDSVAEIAIQGPKAEELLQRLVDYDLSKIEYYHFVKDIK
YKEYDVLISRTGYTGEDGFEVYANAEAIVKLWDELLEKGKDLGVKPCGLGCRDTLRFEAA
MPLYGNELSDEVSPLEVGLKFAVKMDKDDFVGKAKTQEKIDAGINKKLIGIEMQSKRIAR
QGAEVQKDGKTIGKVTTGYLSPTFGVCLANAFVDKSAVALGDEVDVVIRNKPAKATVVKR
KFLDRK
Download sequence
Identical sequences B0S0G2
WP_012290419.1.74057 334413.FMG_0462 gi|169824159|ref|YP_001691770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]