SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|169824427|ref|YP_001692038.1| from Finegoldia magna ATCC 29328

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169824427|ref|YP_001692038.1|
Domain Number 1 Region: 261-347
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000000225
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 60-135
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.00000000177
Family D-glucarate dehydratase-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|169824427|ref|YP_001692038.1|
Sequence length 349
Comment 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase [Finegoldia magna ATCC 29328]
Sequence
MKREDTKRIYVGNVAVGNGARVTVQSMTNTDTKDIESTVKQIKEFESVGCDISRSAINDL
EDAKAIPVIKSMTNIPLVADIQFHHKLAIAAIENGCDCIRINPGNIGGIDRVREVVDCCK
HHKISMRIGVNSGSVNQKFIDKYHGVNVDSICYSCLDQIRMIEDMGFNDIKLSLKSSNVN
MSIKAYEKMSQLCNYPLHVGITEAGPSTKGIIKSSVGIGSILSKGIGDTIRVSLTGDPKE
EIIVGRQILMSLGLLNEGIEIISCPTCARTKIDLISIVNEAEKKLDKIDKHIKVAIMGCV
VNGPGEAKEADLGIAGGNGVGLIFKKGEIIRKVKEEELLDVLIEEIERL
Download sequence
Identical sequences A0A233W907 B0S1A8
334413.FMG_0730 gi|169824427|ref|YP_001692038.1| WP_012290593.1.3294 WP_012290593.1.74057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]