SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|169825114|ref|YP_001692725.1| from Finegoldia magna ATCC 29328

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|169825114|ref|YP_001692725.1|
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000108
Family Tetracyclin repressor-like, N-terminal domain 0.0026
Further Details:      
 
Weak hits

Sequence:  gi|169825114|ref|YP_001692725.1|
Domain Number - Region: 96-134
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0439
Family YmcA-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|169825114|ref|YP_001692725.1|
Sequence length 196
Comment TetR/AcrR family transcriptional regulator [Finegoldia magna ATCC 29328]
Sequence
MEVIYEMKMEADERKKQIRQAAIKVFLDKGFRNTVMNDIMEATGLSRGGLYHHYGSTHEI
LYDIMLEGNKYREKIIYDEMNKTSQDFSEVLSEIILEKMLYQSDYVSIYAMFLQELNHDD
KLKDLYKKLKKSSSDSILMLFDEDVRGELSEAIELITDFINTFILGCEVLNARENFVKNK
LALKKMIGIILDNNAK
Download sequence
Identical sequences B0S395
334413.FMG_1417 gi|169825114|ref|YP_001692725.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]