SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171184897|ref|YP_001793816.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171184897|ref|YP_001793816.1|
Domain Number 1 Region: 3-274
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.75e-80
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00000124
Further Details:      
 
Domain Number 2 Region: 264-477
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 1.94e-64
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171184897|ref|YP_001793816.1|
Sequence length 497
Comment vinylacetyl-CoA Delta-isomerase [Pyrobaculum neutrophilum V24Sta]
Sequence
MGLRTGDQYVEGLRNRKHVKVYVMGKRVEDVTTNLFMKPSLLSFKATFDAAFQEDTRDLA
RAYSPFINEEINRFVHIHQGPQDLVAKVKLLRALSHKTGSCFQRCVGWDGLNTMYIITGK
LAEKGKPVYRERFLKYLEEVQRRDLALAGAMTDARGVRSLRPHEQPNPDAYVRVVEERDD
GIIVRGAKANITGVALVDEVIVMPTRAMTEKDAPYAVAFAVPLDSPGVTVVVGRQINDVR
KAEGDIDGLPYMSHHEGLIIFEDVFVPWDRVFLYQEWQWAGPLVEVFSAFHRQGYAGCKS
GLGDVIIGAAYNLAKQIGVADKPNIVDKLTEMVFLNESMYSAGLAASWEGKKLLKDGGWW
VNPMYANVTKHLVSRFPYEISRLSHDIAGGIIGTAPSEFDLKNSEIRQLVEKYLQGVPEF
TAEDRLRMLRLLENVSVSVGFLIESVHGAGSPAAQKIVFSRLYDFQGAEAVAKRLARMRG
PEPPGTPEPHKKSDVEK
Download sequence
Identical sequences B1YBY6
gi|171184897|ref|YP_001793816.1| 444157.Tneu_0422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]