SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|171186362|ref|YP_001795281.1| from Thermoproteus neutrophilus V24Sta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|171186362|ref|YP_001795281.1|
Domain Number 1 Region: 93-165
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000825
Family Transcription factor IIB (TFIIB), core domain 0.019
Further Details:      
 
Domain Number 2 Region: 30-93
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000113
Family Tetracyclin repressor-like, N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|171186362|ref|YP_001795281.1|
Sequence length 167
Comment hypothetical protein Tneu_1920 [Pyrobaculum neutrophilum V24Sta]
Sequence
MFTYWQRRDDPLSRCIEEVVSSAGGGEDRCLLAAAEYLCRKRAGEATSMDKIAAKYGVSL
LCVYRKYSGLFQVGIRYPRNRVEQLLEQVRQRYGPAVAEEVESLYAVLKSRGALDGLKPE
GVVAALLYYAAKKHGLRYDSHRAAEEFGVHPETVEKNIVLFQWYLQR
Download sequence
Identical sequences B1YBN3
gi|171186362|ref|YP_001795281.1| 444157.Tneu_1920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]