SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182415402|ref|YP_001820468.1| from Opitutus terrae PB90-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182415402|ref|YP_001820468.1|
Domain Number 1 Region: 39-282,348-378
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.14e-78
Family Type II chitinase 0.00000687
Further Details:      
 
Domain Number 2 Region: 282-347
Classification Level Classification E-value
Superfamily Chitinase insertion domain 9.66e-17
Family Chitinase insertion domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182415402|ref|YP_001820468.1|
Sequence length 401
Comment chitinase [Opitutus terrae PB90-1]
Sequence
MHCRPSRSVRSRTSLACRVFALLLGLALAAGTCARSAPAEQAFRLIAYASGHTDFARIPA
AKLTHVNYAFALVNEQAEVYFRSPDSAASHLAALTALKKVNPRLKVLVSIGGWGADHFSD
AALTADTRARFARTAVDLMRQHHLDGIDLDWEYPGHPGPGGLKFRAEDKQNFTLLLRACR
TALDAASAADQRAAGDHYLLTIASSDGDYFDRTEMSSLHAELDWINVMTYDRTGEWSKTT
GHHASLFASKDAPTAPSTDSAVQQHLGAGIPPAKIVVGAAFYGRGWTGVGQQAHGLLQPA
EQPIDGNLSYARLAREFIGRDGYERHWDSDAQAAFLWNPTTGTFITYEDPAALRAKANYV
KQHRLGGVMFWEQAHDPDGVLVEALHATLLAAAPSGAVAAP
Download sequence
Identical sequences B1ZWB6
gi|182415402|ref|YP_001820468.1| 452637.Oter_3591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]