SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|182414599|ref|YP_001819665.1| from Opitutus terrae PB90-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|182414599|ref|YP_001819665.1|
Domain Number 1 Region: 137-199
Classification Level Classification E-value
Superfamily E set domains 0.000000000000997
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|182414599|ref|YP_001819665.1|
Sequence length 307
Comment hypothetical protein Oter_2784 [Opitutus terrae PB90-1]
Sequence
MHTNPIFPARKFLLSLAAAVGLLFLAGCQGIVLTNLTPGSLPENPSQIYTITLRVTPKIQ
TIAPGTLQPYIVIDGQNHQMTKSALGENLYEYEYQLPAGRDEIRYYFIVKYQIEGNGTRT
PGETYSELTSARVVRRYVLSLEVNRGPVGARISVLGRGFTPQDVIYLDNNPARTVFESPN
ALSFFVPALPAGQNYRVMLGSAAGNSPVGTFRIDSSTITVMPSSLTLRTRERQALTFTIA
NPAPAGGLLLDVTTDVPDSVIMPEVIVPQGQSSVTVTVEGGRPGSGSLFLRGYGSGEVSV
PVTVSAN
Download sequence
Identical sequences B1ZW51
gi|182414599|ref|YP_001819665.1| 452637.Oter_2784 WP_012375600.1.87878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]